現(xiàn)貨供應(yīng),歡迎訂購: : CD14 Human Recombinant HEK 10µg 50µg 1mg Catalogue Number PRO-1642 Synonyms Monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, CD14. Introduction CD14 (also known lipopolysaccharide (LPS) receptor) is expressed strongly on monocytes and macrophage and weakly on the surface of neutrophils. CD14 is anchored to cells by linkage to glycosylphosphatidylinositol (GPI) and functions as a high affinity receptor for complexes of LPS and LPS binding protein (LBP). Soluble CD14, also binding to LPS, acts at physiological concentration as an LPS agonist and has, at higher concentrations, an LPS antagonizing effect in cell activation. CD14 has been shown to bind apoptotic cells. Description CD14 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 341 amino acids (20-352). CD14 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques. Source HEK293 cells. Physical Appearance Sterile Filtered White lyophilized (freeze-dried) powder. Formulation CD14 was lyophilized from a 0.2 µM filtered solution of 20mM PB and 150mM NaCl, PH 7.4. Solubility It is recommended to reconstitute the lyophilized CD14 in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions. Stability Lyophilized CD14 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD14 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. Purity Greater than 95% as determined by SDS-PAGE. Amino acid sequence TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVD ADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKIT GTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELWLKPGLKVLSIAQAHSPAF SCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCA ALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKL RVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACVDHHHHHH Usage ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. Related Products CHEMOKINES Related Products ABI3 pro-1227 Recombinant Human ABI Family, Member 3 A2LD1 pro-172 Recombinant Human AIG2-Like Domain 1 A2M pro-551 Human Alpha-2 Macroglobulin Protein ACTA2 pro-1220 Recombinant Human Actin, Alpha 2, Smooth Muscle, Aorta ACTG1 pro-377 Recombinant Human Actin Gamma 1 Actin pro-517 Actin ACTL6A pro-379 Recombinant Human Actin-Like 6A ADAM10 pro-476 Recombinant Human A Disintegrin and Metalloproteinase Domain 10 ADAM12 pro-474 Recombinant Human A Disintegrin and Metalloproteinase Domain 12 S Isoform ADFP pro-405 Recombinant Human Adipose Differentiation-Related Protein Adipsin pro-1360 Recombinant Human Complement Factor D ADRM1 pro-1079 Recombinant Human Adhesion Regulating Molecule 1 AES pro-169 Recombinant Human Amino-Terminal Enhancer of Split AFP pro-406 Human Alpha Fetoprotein Ag85A pro-1076 Recombinant Mycobacterium Tuberculosis major secretory protein Antigen 85A Ag85B pro-589 Recombinant Mycobacterium Tuberculosis major secretory protein Antigen 85B AGR2 pro-580 Recombinant Human Anterior Gradient Protein 2 Homolog AGR3 pro-242 Recombinant Human Anterior Gradient Protein 3 Homolog AHSP pro-720 Recombinant Human Alpha Hemoglobin Stabilizing Protein AIDA pro-1370 Recombinant Human Axin Interactor Dorsalization Associated AIP pro-886 Recombinant Human Aryl Hydrocarbon Receptor Interacting Protein ALK/P80 pro-455 Recombinant Human ALK-P80 Alpha Actinin pro-518 Alpha Actinin AMBP pro-407 Human Alpha-1 Microglobulin AMBP pro-957 Recombinant Human Alpha-1 Microglobulin AMELX pro-1324 Recombinant Human Amelogenin, X-Linked AMN pro-1330 Recombinant Human Amnion Associated Transmembrane Protein AMTN pro-1301 Recombinant Human Amelotin ANAPC13 pro-1037 Recombinant Human Anaphase Promoting Complex Subunit 13 Angiostatin K1-3 pro-284 Recombinant Human Angiostatin Kringles 1-3 Angiostatin K1-4 pro-604 Human Angiostatin Kringles 1-4 ANKRD1 pro-1219 Recombinant Human Ankyrin Repeat Domain 1 ANP32A pro-252 Recombinant Human Acidic Nuclear Phosphoprotein 32 Family, Member A ANXA1 pro-679 Recombinant Human Annexin A1 ANXA10 pro-1045 Recombinant Human Annexin A10 ANXA11 pro-278 Recombinant Human Annexin A11 ANXA13 pro-197 Recombinant Human Annexin A13 ANXA2 pro-777 Recombinant Human Annexin A2 ANXA3 pro-765 Recombinant Human Annexin A3 ANXA4 pro-766 Recombinant Human Annexin A4 ANXA5 pro-732 Recombinant Human Annexin A5 ANXA5 Sf9 pro-137 Recombinant Human Annexin A5, Sf9 ANXA6 pro-767 Recombinant Human Annexin A6 ANXA7 pro-449 Recombinant Human Annexin A7 ANXA8 pro-548 Recombinant Human Annexin A8 ANXA8L2 pro-1138 Recombinant Human Annexin A8 Like-2 ANXA9 pro-450 Recombinant Human Annexin A9 AP1S2 pro-234 Recombinant Human Adaptor-Related Protein Complex 1, Sigma 2 AP2M1 pro-451 Recombinant Human Assembly Protein Complex 2 AP3S1 pro-1280 Recombinant Human Assembly Protein Complex 3 Subunit-1 AP3S2 pro-452 Recombinant Human Assembly Protein Complex 3 Subunit-2 APCS pro-453 Recombinant Human Amyloid P Component APIP pro-1186 Recombinant Human APAF1 interacting protein Apo Transferrin pro-325 Human Apo Transferrin APP pro-1080 Recombinant Human Amyloid beta (A4) Precursor Protein bApo Transferrin pro-511 Bovine Apo Transferrin bAprotinin pro-285 Bovine Aprotinin bAprotinin pro-414 Recombinant Bovine Aprotinin APTX pro-790 Recombinant Human Aprataxin ARC pro-1403 Recombinant Human Activity-Regulated Cytoskeleton-Associated Protein ARF1 pro-867 Recombinant Human ADP-Ribosylation Factor 1 ARF3 pro-933 Recombinant Human ADP-Ribosylation Factor 3 ARF4 pro-066 Recombinant Human ADP-Ribosylation Factor 4 ARF5 pro-245 Recombinant Human ADP-Ribosylation Factor 5 ARF6 pro-032 Recombinant Human ADP-Ribosylation Factor 6 ARFIP2 pro-1201 Recombinant Human ADP-Ribosylation Factor Interacting Protein 2 ARHGDIA pro-002 Recombinant Human Rho GDP Dissociation Inhibitor (GDI) Alpha ARHGDIB pro-1067 Recombinant Human Rho GDP Dissociation Inhibitor (GDI) Beta ARL1 pro-508 Recombinant Human ADP-Ribosylation Factor-Like 1 ARL11 pro-884 Recombinant Human ADP-Ribosylation Factor-Like 11 ARL14 pro-936 Recombinant Human ADP-Ribosylation Factor-Like 14 ARL15 pro-956 Recombinant Human ADP-Ribosylation Factor-Like 15 ARL2 pro-074 Recombinant Human ADP-Ribosylation Factor-Like 2 ARL2BP pro-274 Recombinant Human ADP-Ribosylation Factor-Like 2 Binding Protein ARL3 pro-939 Recombinant Human ADP-Ribosylation Factor-Like 3 ARL4A pro-895 Recombinant Human ADP-Ribosylation Factor-Like 4A ARL4D pro-953 Recombinant Human ADP-Ribosylation Factor-Like 4D ARL5A pro-040 Recombinant Human ADP-Ribosylation Factor-Like 5A ARL5B pro-897 Recombinant Human ADP-Ribosylation Factor-Like 5B ARL6 pro-232 Recombinant Human ADP-Ribosylation Factor-Like 6 ARL9 pro-1009 Recombinant Human ADP-Ribosylation Factor-Like 9 ARPC2 pro-1398 Recombinant Human Actin Related Protein 2/3 Complex, Subunit 2 ARPC5 pro-145 Recombinant Human Actin Related Protein 2/3 Complex, Subunit 5 ARPC3 pro-1413 Recombinant Human Actin Related Protein 2/3 Complex, Subunit 3 ASF1A pro-682 Recombinant Human ASF1 Anti-Silencing Function 1 Homolog A ASF1B pro-1163 Recombinant Human ASF1 Anti-Silencing Function 1 Homolog B ASGR2 pro-1261 Recombinant Human Asialoglycoprotein Receptor 2 ASNA1 pro-1247 Recombinant Human arsA Arsenite Transporter, ATP-Binding, Homolog 1 ATG10 pro-1234 Recombinant Human Autophagy Related 10 ATG4B pro-1048 Recombinant Human ATG4 Autophagy Related 4 Homolog B ATG5 pro-454 Recombinant Human Autophagy Related 5 ATOH1 pro-1073 Recombinant Human Atonal Homolog 1 ATOX1 pro-754 Recombinant Human Copper Transport Protein ATOX1 ATPIF1 pro-1154 Recombinant Human ATPase Inhibitory Factor 1 ATXN3 pro-708 Recombinant Human Ataxin-3 Avidin pro-500 Avidin Avidin-Biotin pro-446 Modified Affinity Purified Avidin B2GP1 pro-388 Recombinant Human Beta 2 Glycoprotein-I B2GP1 pro-552 Human Beta 2 Glycoprotein-I B2M pro-337 Recombinant Human Beta 2 Microglobulin B2M pro-553 Human Beta 2 Microglobulin B2M His pro-859 Recombinant Human Beta 2 Microglobulin, His Tag BAALC pro-758 Recombinant Human Brain and Acute Leukemia, Cytoplasmatic BAD pro-458 Recombinant Human BAD BAG1 pro-817 Recombinant Human BCL2-Associated Athanogene 1 BAG2 pro-168 Recombinant Human BCL2-Associated Athanogene 2 BAG3 pro-760 Recombinant Human BCL2-Associated Athanogene 3 BAIAP2 pro-1022 Recombinant Human BAI1-Associated Protein 2 BASP1 pro-1355 Recombinant Human Brain Abundant Membrane Attached Signal Protein 1 BATF pro-119 Recombinant Human Basic Leucine Zipper Transcription Factor Batroxobin pro-607 Recombinant Batroxobin mBAX pro-412 Recombinant Mouse Bax mBAX GST pro-647 Recombinant Mouse Bax GST Tag bCAPN2 pro-330 Bovine Calpain-2 Catalytic Subunit BCAS2 pro-116 Recombinant Human Breast Carcinoma Amplified Sequence 2 BCDIN3D pro-1262 Recombinant Human BCDIN3D BCL10 pro-1058 Recombinant Human B-cell CLL/Lymphoma 10 Bcl-2 pro-630 Recombinant Human B-Cell Leukemia/Lymphoma 2 Bcl-2 -BH1 pro-631 Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH1 Bcl-2 -BH2 pro-632 Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH2 Bcl-2 -BH3 pro-633 Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH3 Bcl-2 -BH4 pro-411 Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH4 BCL2 His pro-683 Recombinant Human B-Cell Lymphoma Protein 2 Alpha, His Tag Bcl-2 -NWGR pro-634 Recombinant Human B-Cell Leukemia/Lymphoma 2 -NWGR BCL2A1 pro-1102 Recombinant Human BCL2-Related Protein A1 BCL2L10 pro-1321 Recombinant Human BCL2 Like 10 BCL2L11 pro-1171 Recombinant Human BCL2 Like 11 BCL2L2 pro-768 Recombinant Human BCL2 Like 2 BCL6 pro-460 Recombinant Human B-cell CLL/lymphoma 6 BCL7A pro-1318 Recombinant Human B-cell CLL/lymphoma 7A Bcl-XL pro-639 Recombinant Human B-Cell Leukemia/Lymphoma XL Bcl-XL GST pro-640 Recombinant Human B-Cell Leukemia/Lymphoma XL GST Tag Bcl-XL His pro-641 Recombinant Human B-Cell Leukemia/Lymphoma His Tag mBcl-XL pro-1362 Recombinant Mouse B-Cell Leukemia/Lymphoma XL bECGS pro-603 Bovine Endothelial Mitogen BECN1 pro-1289 Recombinant Human Beclin 1, Autophagy Related BGN pro-1382 Recombinant Human Biglycan bFibronectin pro-059 Bovine Fibronectin bHolo Transferrin pro-510 Bovine Holo Transferrin BID pro-627 Recombinant Human BH3 Interacting Domain Death Agonist mBID pro-642 Recombinant Mouse BH3 Interacting Domain Death Agonist mBID GST pro-643 Recombinant Mouse BH3 Interacting Domain Death Agonist GST mtBID pro-644 Recombinant Mouse BH3 Interacting Domain Death Agonist p15 BIN1 pro-546 Recombinant Human Bridging Integrator 1 BIRC5 pro-613 Recombinant Human Baculoviral IAP Repeat-Containing 5 BIRC7 pro-612 Recombinant Human Baculoviral IAP Repeat-Containing 7 BIRC7 (1-280) pro-1042 Recombinant Human Baculoviral IAP Repeat-Containing 7 (1-280 a.a.) Bivalirudin pro-357 Human Bivalirudin BLNK pro-102 Recombinant Human B-Cell Linker BLOC1S2 pro-1094 Recombinant Human Biogenesis of Lysosomal Organelles Complex-1, Subunit 2 BMF pro-700 Recombinant Human Bcl2 Modifying Factor, Isoform 3 bNEFM pro-523 Bovine Neurofilament Medium Polypeptide BOLA1 pro-302 Recombinant Human BolA Homolog 1 BP-1 pro-463 Recombinant Human BP-1 BPI pro-129 Human Bactericidal/Permeability-Increasing Protein BPIFA1 pro-404 Recombinant Human BPI fold containing family A Member 1 BSA pro-422 Bovine Serum Albumin bSNRPD pro-998 Bovine Small Nuclear Ribonucleoprotein Polypeptide BTF3 pro-1333 Recombinant Human Basic Transcription Factor 3 BUB3 pro-023 Recombinant Human BUB3 bThrombin pro-447 Bovine Thrombin bTROVE2 pro-111 Bovine TROVE Domain Family, Member 2 bTrypsin pro-313 Recombinant Bovine Trypsin bVimentin pro-525 Bovine Vimentin C7ORF49 pro-1415 Recombinant Human Chromosome 7 Open Reading Frame 49 C12ORF5 pro-051 Recombinant Human Chromosome 12 Open Reading Frame 5 C14ORF129 pro-193 Recombinant Human Chromosome 14 Open Reading Frame 129 C16ORF53 pro-225 Recombinant Human Chromosome 16 Open Reading Frame 53 C17ORF49 pro-1192 Recombinant Human Chromosome 17 Open Reading Frame 49 C1q pro-554 Human Complement Component C1q C1QBP pro-636 Recombinant Human Complement Component 1 C1QTNF1 pro-654 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 1 C1QTNF2 pro-133 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 2 C1QTNF3 pro-653 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 3 C1QTNF6 pro-655 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 6 C1QTNF7 pro-514 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 7 C1QTNF8 pro-134 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 8 C1QTNF9 pro-135 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 9 C20ORF20 pro-1000 Recombinant Human Chromosome 20 Open Reading Frame 20 C3c pro-555 Human Complement Component C3c C4BPB pro-1174 Recombinant Human Complement Component 4 Binding Protein, Beta C4c pro-556 Human Complement Component C4c mC5a pro-085 Recombinant Mouse Complement Component C5a C6ORF108 pro-249 Recombinant Human Chromosome 6 Open Reading Frame 108 C8G pro-947 Recombinant Human Complement Component 8, Gamma C9ORF103 pro-1025 Recombinant Human Chromosome 9 Open Reading Frame 103 C9ORF95 pro-1116 Recombinant Human Chromosome 9 Open Reading Frame 95 CAB39 pro-857 Recombinant Human Calcium Binding Protein 39 CAB39L pro-020 Recombinant Human Calcium Binding Protein 39 Like CABP7 pro-211 Recombinant Human Calcium Binding Protein 7 CACYBP pro-831 Recombinant Human Calcyclin Binding Protein Cadherin-E pro-461 Recombinant Human Cadherin-E CALB1 pro-721 Recombinant Human Calbindin-1 CALB2 pro-401 Recombinant Human Calbindin-2 mCALB2 pro-290 Recombinant Mouse Calbindin-2 CALM2 pro-618 Recombinant Human Calmodulin-2 CALM2 135 a.a. pro-370 Recombinant Human Calmodulin-2 135 a.a. CALML3 pro-1323 Recombinant Human Calmodulin Like 3 CALN1 pro-279 Recombinant Human Calnueron-1 CALR pro-813 Recombinant Human Calreticulin Calumenin pro-696 Recombinant Human Calumenin CAMP pro-1405 Recombinant Human Cathelicidin Antimicrobial Peptide CANT1 pro-1010 Recombinant Human Calcium Activated Nucleotidase 1 CANX pro-725 Recombinant Human Calnexin CAPG pro-759 Recombinant Human Capping Protein Gelsolin-Like CAPN1 pro-363 Human Calpain-1 Catalytic Subunit CAPS pro-117 Recombinant Human Calcyphosine CAPSL pro-185 Recombinant Human Calcyphosine-Like CARD18 pro-1061 Recombinant Human Caspase Recruitment Domain Family, Member 18 Cardiac Actin pro-519 Cardiac Actin CARHSP1 pro-257 Recombinant Human Calcium Regulated Heat Stable Protein 1 CASQ2 pro-799 Recombinant Human Calsequestrin CBFB pro-534 Recombinant Human Core Binding Factor Beta CBX1 pro-876 Recombinant Human Chromobox Homolog 1 CBX3 pro-1057 Recombinant Human Chromobox Homolog 3 CBX5 pro-1062 Recombinant Human Chromobox Homolog 5 CCDC43 pro-1398 Recombinant Human Coiled-Coil Domain Containing 43 CCDC101 pro-1063 Recombinant Human Coiled-Coil Domain Containing 101 CCND2 pro-1012 Recombinant Human Cyclin D2 CCNG1 pro-1005 Recombinant Human Cyclin G1 CCS pro-251 Recombinant Human Copper Chaperone for Superoxide Dismutase CD11b pro-472 Recombinant Human CD11b CD14-CHO pro-536 Recombinant Human CD14 CHO derived mCD14 pro-537 Recombinant Mouse CD14 CD1B pro-1267 Recombinant Human CD1B CD2 pro-1337 Recombinant Human CD2 CD2 GST pro-468 Recombinant Human CD2, GST Tag CD23 pro-470 Recombinant Human CD23 CD226 pro-1353 Recombinant Human CD226 CD244 pro-1173 Recombinant Human CD244 CD247 pro-1335 Recombinant Human CD247 CD27 pro-1213 Recombinant Human CD27 CD274 pro-1103 Recombinant Human CD274 mCD274 pro-1164 Recombinant Mouse CD274 CD300C pro-273 Recombinant Human CD300C CD30 pro-1369 Recombinant Human CD30 CD3G pro-1392 Recombinant Human CD3 Gamma CD34 GST pro-292 Recombinant Human CD34 GST Tag CD34 pro-1363 Recombinant Human CD34 CD3e pro-1317 Recombinant Human CD3e CD45 pro-482 Recombinant Human CD45 CD46 pro-1414 Recombinant Human CD46 CD56 pro-483 Recombinant Human CD56 CD68 pro-1209 Recombinant Human CD68 CD68, 38 kda pro-293 Recombinant Human CD68, 38kda CD72 pro-486 Recombinant Human CD72 CD79B pro-1304 Recombinant Human CD79B CD83 pro-019 Recombinant Human CD83 CD84 pro-1229 Recombinant Human CD84 CD95 His pro-594 Recombinant Human CD95, His Tag CD99 pro-294 Recombinant Human CD99 CDC26 pro-241 Recombinant Human Cell Division Cycle 26 CDC37 pro-464 Recombinant Human Cell Division Cycle 37 CDC37, His pro-140 Recombinant Human Cell Division Cycle 37, His Tag CDC42 pro-727 Recombinant Human Cell Division Cycle 42 CDCA8 pro-222 Recombinant Human Cell Division Cycle Associated 8 CDH11 pro-1368 Recombinant Human Cadherin 11 CEA pro-287 Recombinant Human Carcinoembryonic Antigen CEBP-a pro-433 Recombinant Human CCAAT/enhancer binding protein(C/EBP) Alpha CEBP-g pro-434 Recombinant Human CCAAT/enhancer binding protein(C/EBP) Gamma CENPA pro-389 Recombinant Human Centromere Protein-A CENPB pro-390 Recombinant Human Centromere Protein-B CENPH pro-966 Recombinant Human Centromere Protein-H CETN1 pro-1104 Recombinant Human Centrin-1 CETN2 pro-060 Recombinant Human Centrin-2 CETN3 pro-533 Recombinant Human Centrin-3 CFL1 pro-591 Recombinant Human Cofilin-1 CFL2 pro-912 Recombinant Human Cofilin-2 CFLAR pro-920 Recombinant Human CASP8 and FADD-Like Apoptosis Regulator CHD4 pro-112 Recombinant Human Chromodomain Helicase DNA Binding Protein 4 CHGA pro-692 Recombinant Human Chromogranin A CHGA GST pro-491 Recombinant Human Chromogranin A GST Tag CHGA His pro-699 Recombinant Human Chromogranin A His Tag CHGB pro-824 Recombinant Human Chromogranin B CHMP1A pro-1308 Recombinant Human Chromatin Modifying Protein 1A CHMP1B pro-1117 Recombinant Human Charged Multivesicular Body Protein 1B CHMP2A pro-503 Recombinant Human Chromatin Modifying Protein 2A CHMP2B pro-877 Recombinant Human Chromatin Modifying Protein 2B CHMP4A pro-1024 Recombinant Human Chromatin Modifying Protein 4A CHMP5 pro-1232 Recombinant Human Charged Multivesicular Body Protein 5 CHMP6 pro-1085 Recombinant Human Charged Multivesicular Body Protein 6 CHP1 pro-847 Recombinant Human Calcium Binding Protein P22 CHRAC1 pro-1391 Recombinant Human Chromatin Accessibility Complex 1 CIAO1 pro-1396 Recombinant Human Cytosolic Iron-Sulfur Protein Assembly 1 CIAPIN1 pro-024 Recombinant Human Cytokine Induced Apoptosis Inhibitor 1 CIRBP pro-746 Recombinant Human Cold Inducible RNA Binding Protein CISD1 pro-1221 Recombinant Human CDGSH Iron Sulfur Domain 1 CITED2 pro-701 Recombinant Human Cbp/p300-Interacting Transactivator 2 CLDN4 pro-203 Recombinant Human Claudin-4 CLEC2B pro-526 Recombinant Human C-type Lectin Domain Family 2, Member B CLIC1 pro-833 Recombinant Human Chloride Intracellular Channel 1 CLIC2 pro-198 Recombinant Human Chloride Intracellular Channel 2 CLIC4 pro-173 Recombinant Human Chloride Intracellular Channel 4 CLNS1A pro-1277 Recombinant Human Chloride Channel, Nucleotide-Sensitive, 1A CLTA pro-1144 Recombinant Human Clathrin, Light Chain A CLTB pro-1172 Recombinant Human Clathrin, Light Chain B CNBP pro-1371 Recombinant Human Cellular Nucleic Acid Binding Protein CNN1 pro-1129 Recombinant Human Calponin 1, Basic, Smooth Muscle CNPY3 pro-1386 Recombinant Human Canopy 3 Homolog mCNOT7 pro-908 Recombinant Mouse CCR4-NOT Transcription Complex, Subunit 7 CNRIP1 pro-1214 Recombinant Human Cannabinoid Receptor Interacting Protein 1 COL4A3 pro-387 Recombinant Human Collagen Type IV Alpha 3 COL4A3BP pro-837 Recombinant Human Collagen Type IV Alpha 3 Binding Protein Collagen pro-359 Recombinant Human Like Collagen Collagen-3 pro-480 Recombinant Human Collagen-3 COMMD1 pro-862 Recombinant Human Copper Metabolism Domain Containing 1 COMMD9 pro-1244 Recombinant Human COMM Domain Containing 9 COMP HEK pro-132 Recombinant Human Cartilage Oligomeric Matrix Protein, HEK COPS8 pro-983 Recombinant Human COP9 Constitutive Photomorphogenic 8 COPZ1 pro-221 Recombinant Human Coatomer Protein Complex, Subunit Zeta 1 COTL1 pro-064 Recombinant Human Coactosin-Like 1 COX4NB pro-917 Recombinant Human COX4NB COX5A pro-1331 Recombinant Human Cytochrome C Oxidase Subunit Va CPLX1 pro-645 Recombinant Human Complexin-1 CPSF4 pro-1406 Recombinant Human Cleavage And Polyadenylation Specific Factor 4 CRABP1 pro-710 Recombinant Human Cellular Retinoic Acid Binding Protein 1 CRABP2 pro-637 Recombinant Human Cellular Retinoic Acid binding Protein 2 CRADD pro-465 Recombinant Human Caspase and RIP Adapter with Death Domain CRCP pro-919 Recombinant Human CGRP Receptor Component CREG1 pro-1196 Recombinant Human Cellular Repressor of E1A-Stimulated Genes 1 CRIPT pro-1105 Recombinant Human Cysteine-Rich PDZ-Binding Protein CRISP1 pro-473 Recombinant Human Cysteine-Rich Secretory Protein 1 CRK pro-275 Recombinant Human V-crk Sarcoma Virus CT10 Oncogene CRKL pro-063 Recombinant Human V-crk Sarcoma Virus CT10 Oncogene Homolog (Avian)-Like CRMP-1 pro-493 Recombinant Human Collapsin Response Mediator Protein-1 CRNN pro-797 Recombinant Human Cornulin CRP pro-335 Recombinant Human C-Reactive Protein CRP pro-557 Human C-Reactive Protein CRP (19-224 a.a.) pro-914 Recombinant Human C-Reactive Protein (19-224 a.a.) CRYGC pro-1095 Recombinant Human Crystallin, Gamma C CRYGD pro-913 Recombinant Human Crystallin, Gamma D CRYGN pro-1152 Recombinant Human Crystallin, Gamma N CRYGS pro-963 Recombinant Human Crystallin, Gamma S CSN2 pro-1047 Recombinant Human Casein Beta CSRP2 pro-1096 Recombinant Human Cysteine and Glycine-rich Protein 2 CST1 pro-1006 Recombinant Human Cystatin SN CST3 pro-656 Recombinant Human Cystatin C CST3 pro-413 Human Cystatin C mCST3 pro-597 Recombinant Mouse Cystatin-C rCST3 pro-438 Recombinant Rat Cystatin C CST3 Active pro-961 Recombinant Human Cystatin C Active CST4 pro-1097 Recombinant Human Cystatin 4 CST6 pro-892 Recombinant Human Cystatin E/M CST9 pro-955 Recombinant Human Cystatin 9 CSTA pro-086 Recombinant Human Cystatin-A CSTA GST pro-543 Recombinant Human Cystatin-A, GST tag CSTA His pro-504 Recombinant Human Cystatin-A His Tag CSTB pro-609 Recombinant Human Cystatin-B CSTF1 pro-1170 Recombinant Human Cleavage Stimulation Factor 1 CTBP1 pro-796 Recombinant Human C-Terminal Binding Protein 1 CTNNBIP1 pro-850 Recombinant Human Catenin, Beta Interacting Protein 1 CUL1 pro-268 Recombinant Human Cullin-1 CUTA pro-812 Recombinant Human CutA Divalent Cation Tolerance Homolog CUTC pro-911 Recombinant Human cutC Copper Transporter Homolog CYB5A pro-910 Recombinant Human Cytochrome B5 Type A CYB5R3 pro-1026 Recombinant Human Cytochrome B5 Reductase 3 Cyclosporin-A pro-408 Cyclosporin-A CYGB pro-842 Recombinant Human Cytoglobin Cys-Protein-G His pro-1238 Recombinant Cys-Protein G His Tag CYTH2 pro-1248 Recombinant Human Cytohesin 2 D4GDI pro-296 Recombinant Human D4-GDI DBI pro-832 Recombinant Human Diazepam Binding Inhibitor DBNDD1 pro-1162 Recombinant Human Dysbindin (Dystrobrevin Binding Protein 1) Domain Containing 1 DBNDD2 pro-1167 Recombinant Human Dysbindin (Dystrobrevin Binding Protein 1) Domain Containing 2 DCAF7 pro-909 Recombinant Human DDB1 and CUL4 Associated Factor 7 dCASQ2 pro-410 Dog Calsequestrin-2 DCUN1D1 pro-078 Recombinant Human DCN1 Defective in Cullin Neddylation 1 Domain Containing 1 DCUN1D2 pro-899 Recombinant Human DCN1 Defective in Cullin Neddylation 1 Domain Containing 2 DDIT3 pro-638 Recombinant Human DNA Damage Inducible Transcript 3 DDIT4 pro-094 Recombinant Human DNA Damage Inducible Transcript 4 DEDD pro-1349 Recombinant Human Death Effector Domain Containing DENR pro-926 Recombinant Human Density-Regulated Protein Desmin pro-520 Recombinant Human Desmin DFFA pro-718 Recombinant Human DNA Fragmentation Factor Subunit Alpha DGCR6 pro-1372 Recombinant Human DiGeorge Syndrome Critical Region Gene 6 DIRAS1 pro-256 Recombinant Human DIRAS family, GTP-binding RAS-like 1 DKK1 pro-673 Recombinant Human Dickkopf-Related Protein 1 DKK1 HEK pro-815 Recombinant Human Dickkopf-Related Protein 1 HEK DKK2 pro-1205 Recombinant Human Dickkopf-Related Protein 2 DKK3 pro-1175 Recombinant Human Dickkopf-Related Protein 3 DNAL1 pro-1357 Recombinant Human Dynein Axonemal Light Chain 1 DNAL4 pro-227 Recombinant Human Dynein Axonemal Light Chain 4 DPPA3 pro-1291 Recombinant Human Developmental Pluripotency Associated 3 DR1 pro-542 Recombinant Human Down-Regulator of Transcription 1 DRG1 pro-885 Recombinant Human Developmentally Regulated GTP Binding Protein 1 DSTN pro-1137 Recombinant Human Destrin DTNBP1 pro-675 Recombinant Human Dystrobrevin-Binding Protein 1 Isoform C DYNLL1 pro-262 Recombinant Human Dynein Light Chain LC8 Type-1 DYNLL2 pro-235 Recombinant Human Dynein Light Chain LC8 Type-2 DYNLRB1 pro-489 Recombinant Human Dynein Light Chain Roadblock-Type 1 DYNLRB2 pro-174 Recombinant Human Dynein Light Chain Roadblock-Type 2 DYNLT1 pro-757 Recombinant Human Dynein, Light Chain, Tctex-Type 1 DYNLT3 pro-1197 Recombinant Human Dynein, Light Chain, Tctex-Type 3 EBAG9 pro-343 Recombinant Human Estrogen Receptor Binding Site Associated Antigen 9 ECSIT pro-1241 Recombinant Human ECSIT homolog EDF1 pro-494 Recombinant Human Endothelial Differentiation-Related Factor 1 EEF1B2 pro-167 Recombinant Human Eukaryotic Translation Elongation Factor 1 Beta 2 EEF1D pro-170 Recombinant Human Eukaryotic Translation Elongation Factor 1 Delta EEF1E1 pro-199 Recombinant Human Eukaryotic Translation Elongation Factor 1 Epsilon 1 EFNA1 pro-971 Recombinant Human Ephrin A1 EFNA4 pro-498 Recombinant Human Ephrin A4 EFNB1 pro-918 Recombinant Human Ephrin- B1 EFNB2 pro-937 Recombinant Human Ephrin- B2 EFNB3 pro-1169 Recombinant Human Ephrin- B3 EGLN3 pro-1143 Recombinant Human Egl Nine Homolog 3 EIF1 pro-773 Recombinant Human Eukaryotic Translation Initiation Factor 1 EIF1AX pro-253 Recombinant Human Eukaryotic Translation Initiation Factor 1A X-linked EIF1AY pro-098 Recombinant Human Eukaryotic Translation Initiation Factor 1A Y-linked EIF1B pro-175 Recombinant Human Eukaryotic Translation Initiation Factor 1B EIF2B1 pro-209 Recombinant Human Eukaryotic Translation Initiation Factor 2B Subunit 1 Alpha EIF2S1 pro-845 Recombinant Human Eukaryotic Translation Initiation Factor 2 Subunit 1 Alpha EIF3J pro-970 Recombinant Human Eukaryotic Translation Initiation Factor 3J EIF3K pro-179 Recombinant Human Eukaryotic Translation Initiation Factor 3K EIF4A3 pro-1007 Recombinant Human Eukaryotic Translation Initiation Factor 4A3 EIF4E pro-530 Recombinant Human Eukaryotic Translation Initiation Factor 4E EIF4EBP1 pro-532 Recombinant Human Eukaryotic Translation Initiation Factor 4E-Binding Protein 1 EIF4EBP2 pro-176 Recombinant Human Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 EIF4H pro-1114 Recombinant Human Eukaryotic Translation Initiation Factor 4H EIF5A pro-674 Recombinant Human Eukaryotic Translation Initiation Factor 5A EIF5A2 pro-846 Recombinant Human Eukaryotic Translation Initiation Factor 5A2 Eledoisin pro-281 Eledoisin EMCN pro-1156 Recombinant Human Endomucin EMG1 pro-1122 Recombinant Human EMG1 Nucleolar Protein Endostatin pro-248 Recombinant Human Endostatin Enfuvirtide pro-376 Enfuvirtide T-20 ENSA pro-772 Recombinant Human Endosulfine Alpha EPCAM pro-1322 Recombinant Human Epithelial Cell Adhesion Molecule Eptifibatide pro-358 Human Eptifibatide ER-a pro-499 Recombinant Human Estrogen Receptor Alpha ERCC1 pro-1106 Recombinant Human Excision Repair Cross-Complementing 1 ERCC1, GST pro-496 Recombinant Human Excision Repair Cross-Complementing 1, GST Tag ERH pro-121 Recombinant Human Enhancer of Rudimentary ERLIN2 pro-1266 Recombinant Human ER Lipid Raft Associated 2 ERP27 pro-046 Recombinant Human Endoplasmic Reticulum Protein 27 ERP44 pro-547 Recombinant Human Endoplasmic Reticulum Protein 44 ESAT6 pro-291 Recombinant Early Secretory Target Mycobacterium Tuberculosis E-Selectin pro-380 Recombinant Human E-Selectin ESM1 pro-1328 Recombinant Human Endothelial Cell-Specific Molecule 1 ETFB pro-220 Recombinant Human Electron-Transfer-Flavoprotein Beta Polypeptide ETHE1 pro-1027 Recombinant Human Ethylmalonic Encephalopathy 1 ETS1 pro-501 Recombinant Human C-ets-1 Protein EXOSC10 pro-444 Recombinant Human Exosome Component 10 EXOSC5 pro-1059 Recombinant Human Exosome Component 5 EXOSC9 pro-126 Recombinant Human Exosome Component 9 EYA2 pro-1071 Recombinant Human Eyes Absent Homolog 2 F11R pro-1112 Recombinant Human F11 Receptor F3 pro-312 Recombinant Human Coagulation Factor III F7 pro-331 Recombinant Human Coagulation Factor VIIa F8 pro-317 Human Coagulation Factor VIII F8 pro-318 Recombinant Human Coagulation Factor VIII F9 pro-353 Human Coagulation Factor IX FABP1 pro-588 Recombinant Human Fatty Acid Binding Protein-1 mFABP1 pro-1121 Recombinant Mouse Fatty Acid Binding Protein-1 FABP12 pro-738 Recombinant Human Fatty Acid Binding Protein-12 FABP2 pro-669 Recombinant Human Fatty Acid Binding Protein-2 FABP3 pro-340 Recombinant Human Fatty Acid Binding Protein-3 FABP3 His pro-668 Recombinant Human Fatty Acid Binding Protein-3, His Tag FABP4 pro-416 Recombinant Human Fatty Acid Binding Protein-4 FABP4 His pro-566 Recombinant Human Fatty Acid Binding Protein-4, His Tag FABP5 pro-417 Recombinant Human Fatty Acid Binding Protein-5 FABP5 His pro-666 Recombinant Human Fatty Acid Binding Protein-5, His Tag FABP6 pro-649 Recombinant Human Fatty Acid Binding Protein-6 FABP6 His pro-667 Recombinant Human Fatty Acid Binding Protein-6, His Tag FABP7 pro-628 Recombinant Human Fatty Acid Binding Protein-7 FABP7 His pro-661 Recombinant Human Fatty Acid Binding Protein-7, His Tag FABP9 pro-1088 Recombinant Human Fatty Acid Binding Protein-9 FADD pro-733 Recombinant Human Fas-Associated Death Domain FAM3B pro-139 Recombinant Human Family with Sequence Similarity 3, Member B FAM3C pro-952 Recombinant Human Family with Sequence Similarity 3, Member C FAM49B pro-1411 Recombinant Human Family with Sequence Similarity 49, Member B FCGR1A pro-1228 Recombinant Human CD64 FCGR2A pro-029 Recombinant Human CD32a FCGR2B pro-1295 Recombinant Human CD32 FCGR3A pro-1150 Recombinant Human CD16a FDCSP pro-1339 Recombinant Human Follicular Dendritic Cell Secreted Protein FDX1 pro-713 Recombinant Human Ferredoxin-1 Ferritin pro-564 Human Liver Ferritin Ferritin Heavy pro-658 Recombinant Human Ferritin Heavy Chain Ferritin Light pro-650 Recombinant Human Ferritin Light Chain Fetuin-A pro-418 Human Alpha-2-HS-Glycoprotein FHIT pro-828 Recombinant Human Fragile Histidine Triad FHIT, GST pro-297 Recombinant Human Fragile Histidine Triad, GST Tag Fibronectin pro-448 Human Fibronectin Filamin pro-521 Filamin FIMC pro-120 Recombinant E.Coli Chaperone Protein fimC FIS1 pro-829 Recombinant Human Fission-1 Flagellin pro-1240 Recombinant Flagellin FOPNL pro-1195 Recombinant Human FGFR1OP N-terminal like FOS-B pro-505 Recombinant Human FOS-B Frataxin pro-761 Recombinant Human Frataxin FRZB pro-1345 Recombinant Human Frizzled-Related Protein FSCN1 pro-527 Recombinant Human Fascin FTSJ2 pro-1207 Recombinant Human FtsJ RNA Methyltransferase Homolog 2 FUBP1 pro-1132 Recombinant Human Far Upstream Element Binding Protein FUR pro-622 Recombinant E.Coli Ferric Uptake Regulator FXYD5 pro-1366 Recombinant Human FXYD5 Fyn-p59 pro-506 Recombinant Human Fyn-p59 FZD1 pro-816 Recombinant Human Frizzled-1 GABARAP pro-775 Recombinant Human GABA(A) Receptor-Associated Protein GABARAPL1 pro-048 Recombinant Human GABA(A) Receptor-Associated Protein Like 1 GABARAPL2 pro-079 Recombinant Human GABA(A) Receptor-Associated Protein Like 2 GADD45A pro-783 Recombinant Human Growth Arrest and DNA-Damage-Inducible Alpha GADD45B pro-563 Recombinant Human Growth Arrest and DNA-Damage-Inducible Beta GADD45G pro-570 Recombinant Human Growth Arrest and DNA-Damage-Inducible Gamma GADD45GIP1 pro-972 Recombinant Human Growth Arrest and DNA-Damage-Inducible Gamma Interacting Protein 1 GAGA-POZ pro-435 Recombinant Drosophila melanogaster GAGA-POZ GAP43 pro-1126 Recombinant Human Growth Associated Protein 43 GAS7 pro-680 Recombinant Human Growth Arrest-Specific 7, Isoform b GCA pro-080 Recombinant Human Grancalcin GCSAM pro-1282 Recombinant Human Germinal Center-Associated, Signaling and Motility GCSH pro-973 Recombinant Human Glycine Cleavage System Protein H GCV syn-001 Ganciclovir Gelatin pro-481 Recombinant Human Gelatin GEMIN6 pro-1394 Recombinant Human Gem-Associated Protein 6 GFER pro-1326 Recombinant Human Growth Factor, Augmenter of Liver Regeneration GFP pro-522 Glial Filament Protein GINS4 pro-1270 Recombinant Human GINS Complex Subunit 4 GIPC1 pro-855 Recombinant Human GIPC PDZ Domain Member 1 GIPC2 pro-1035 Recombinant Human GIPC PDZ Domain Member 2 GKN1 pro-1206 Recombinant Human Gastrokine 1 GLC8 pro-540 Recombinant Yeast GLC8 Gliadin pro-114 Recombinant Wheat Gliadin GLIPR2 pro-550 Recombinant Human GLI Pathogenesis-Related 2 GLOD4 pro-894 Recombinant Human Glyoxalase Domain Containing 4 GLTP pro-1313 Recombinant Human Glycolipid Transfer Protein GMNN pro-579 Recombinant Human Geminin GNAI1 pro-940 Recombinant Human Guanine Nucleotide Binding Protein Alpha Inhibiting Activity 1 GNAI2 pro-1310 Recombinant Human Guanine Nucleotide Binding Protein-G Alpha Inhibiting Activity Polypeptide 2 GNAI3 pro-1074 Recombinant Human Guanine Nucleotide Binding Protein Alpha Inhibiting Activity 3 GNAZ pro-1225 Recombinant Human Guanine Nucleotide Binding Protein Alpha Z Polypeptide GNB2L1 pro-1023 Recombinant Human Guanine Nucleotide Binding Protein beta polypeptide 2-like 1 GNLY pro-852 Recombinant Human Granulysin GOPC pro-793 Recombinant Human Golgi-Associated PDZ and Coiled-Coil Motif Containing GOSR2 pro-1399 Recombinant Human Golgi SNAP Receptor Complex Member 2 GP2 pro-115 Recombinant Human Glycoprotein-2 GP9 pro-055 Recombinant Human Glycoprotein-9 GPN1 pro-1140 Recombinant Human GPN-loop GTPase 1 GRAP2 pro-081 Recombinant Human GRB2-Related Adaptor Protein 2 GRB2 pro-678 Recombinant Human Growth Factor Receptor-Bound Protein 2 GREM1 pro-1359 Recombinant Human GREM1 GRPEL1 pro-263 Recombinant Human GrpE-Like 1 GTF2B pro-762 Recombinant Human General Transcription Factor IIB GTF2E2 pro-1107 Recombinant Human General Transcription Factor IIE, Polypeptide 2 GTF2F2 pro-1093 Recombinant Human General Transcription Factor IIF, Polypeptide 2 GULP1 pro-1398 Recombinant Human GULP1 HAND1 pro-1231 Recombinant Human Heart and Neural Crest Derivatives Expressed 1 Haptoglobin pro-567 Recombinant Human Haptoglobin Haptoglobin pro-558 Human Haptoglobin HAUS1 pro-1077 Recombinant Human HAUS Augmin-Like Complex, Subunit 1 HAX1 pro-1367 Recombinant Human HCLS1 Associated Protein X-1 HbA1c pro-299 Human Hemoglobin A1c HBA2 pro-1183 Recombinant Human Hemoglobin, Alpha 2 HBG2 pro-021 Recombinant Human Hemoglobin Gamma G HBZ pro-803 Recombinant Human Hemoglobin-Zeta HDL pro-559 Human High Density Lipoprotein HEBP1 pro-1316 Recombinant Human Heme Binding Protein 1 Hemopexin pro-560 Human Hemopexin HES7 pro-1306 Recombinant Human Hairy and Enhancer of Split 7 HEXIM1 pro-789 Recombinant Human Hexamethylene Bis-Acetamide Inducible 1 HFE pro-1332 Recombinant Human Hemochromatosis HIF1A pro-477 Recombinant Human Hypoxia-Inducible Factor-1 Alpha HIF1A (85 a.a.) pro-258 Recombinant Human Hypoxia-Inducible Factor-1 Alpha (85 a.a.) HIF1A His pro-415 Recombinant Human Hypoxia-Inducible Factor-1 Alpha His Tag HIF1AN pro-662 Recombinant Human Hypoxia-Inducible Factor-1 Alpha Inhibitor HINT1 pro-702 Recombinant Human Histidine Triad Nucleotide Binding Protein 1 Hirudin pro-362 Recombinant Hirudin HLF pro-904 Recombinant Human Hepatic Leukemia Factor HMGA1 pro-887 Recombinant Human High Mobility Group AT-Hook 1 HMGB1 pro-581 Recombinant Human High-Mobility Group Box 1 HMGB1 Hi-5 pro-610 Recombinant Human High-Mobility Group Box 1 Hi-5 Insect Cells HMGB2 pro-888 Recombinant Human High-Mobility Group Box 2 HMGN1 pro-821 Recombinant Human High-Mobility Group Nucleosome Binding Domain 1 HN1L pro-027 Recombinant Human Hematological and Neurological Expressed 1-Like HNRNPA1 pro-1038 Recombinant Human Heterogeneous Nuclear Ribonucleoprotein A1 HNRNPC pro-177 Recombinant Human Heterogeneous Nuclear Ribonucleoprotein C Holo Transferrin pro-315 Human Holo Transferrin HOMER1 pro-695 Recombinant Human Homer Homolog-1 HOMER2 pro-1072 Recombinant Human Homer Homolog-2 HOMER3 pro-1108 Recombinant Human Homer Homolog-3 HOPX pro-1158 Recombinant Human HOP homeobox HPCAL1 pro-254 Recombinant Human Hippocalcin-Like 1 HPG1 pro-423 Recombinant Human Prostate Specific Gene-1 HRAS pro-822 Recombinant Human V-Ha-ras Harvey Rat Sarcoma Viral Oncogene Homolog HRSP12 pro-052 Recombinant Human Heat-Responsive Protein 12 HSA pro-354 Human Serum Albumin HSCB pro-1142 Recombinant Human HscB Iron-Sulfur Cluster Co-Chaperone HSD17B10 pro-823 Recombinant Human Hydroxysteroid (17-beta) Dehydrogenase 10 HUS1 pro-039 Recombinant Human HUS1 Checkpoint Homolog ICAM-1 pro-383 Recombinant Human Intercellular Adhesion Molecule-1 ICT1 pro-1303 Recombinant Human Immature Colon Carcinoma Transcript 1 ID2 pro-1383 Recombinant Human Inhibitor of DNA Binding 2 IFT20 pro-1222 Recombinant Human Intraflagellar Transport 20 Homolog IGLL1 pro-1390 Recombinant Human Immunoglobulin Lambda-Like Polypeptide 1 IGJ pro-1416 Recombinant Human Immunoglobulin J IMP3 pro-015 Recombinant Human IMP3 IMPAD1 pro-1346 Recombinant Human Inositol Monophosphatase Domain Containing 1 mIgG pro-1087 Recombinant Mouse Immunoglobulin Heavy Chain Constant Region Gamma 2a mIgG His pro-1086 Recombinant Mouse Immunoglobulin Heavy Chain Constant Region Gamma 2a, His Tag Intein pro-958 Recombinant Bacillus Circulans Intein Internalin pro-031 Recombinant Listeria Monocytogenes Internalin Intrinsic Factor pro-375 Recombinant Human Intrinsic Factor Involucrin pro-512 Recombinant Human Involucrin IPP-POZ pro-436 Recombinant Human IPP-POZ IRGM pro-1302 Recombinant Human Immunity-Related GTPase Family, M ISCU pro-072 Recombinant Human Iron-sulfur Cluster Scaffold Homolog ISG15 pro-611 Recombinant Human Interferon Stimulated Gene 15 ITGB1BP3 pro-1177 Recombinant Human Integrin Beta 1 Binding Protein 3 JAM2 pro-1336 Recombinant Human Junctional Adhesion Molecule 2 JAM3 pro-1223 Recombinant Human Junctional Adhesion Molecule 3 JOSD1 pro-1251 Recombinant Human Josephin Domain Containing 1 k9Cystatin-C pro-138 Recombinant Canine Cystatin-C KAAG1 pro-192 Recombinant Human Kidney Associated Antigen 1 KCNIP3 pro-009 Recombinant Human Kv Channel Interacting Protein 3 KCTD5 pro-1276 Recombinant Human Potassium Channel Tetramerisation Domain Containing 5 KCTD11 pro-1376 Recombinant Human Potassium Channel Tetramerisation Domain Containing 11 KCTD15 pro-1002 Recombinant Human Potassium Channel Tetramerisation Domain Containing 15 KIN pro-1275 Recombinant Human KIN KIR2DL1 pro-428 Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Long Cytoplasmic Tail 1 KIR2DL3 pro-429 Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Long Cytoplasmic Tail 3 KIR2DS4 pro-430 Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Short Cytoplasmic Tail 4 KIR3DL1 pro-427 Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 3 Domains Long Cytoplasmic Tail 1 KISS1 pro-419 Recombinant Human KISS-1 Metastasis-Suppressor KLF4 pro-891 Recombinant Human Kruppel-Like Factor 4 KLRB1 pro-1189 Recombinant Human Killer Cell Lectin-Like Receptor Subfamily B, Member 1 KLRC2 pro-1190 Recombinant Human Killer Cell Lectin-Like Receptor Subfamily C, Member 2 KLRC3 pro-1230 Recombinant Human Killer Cell Lectin-Like Receptor Subfamily C, Member 3 KLRG1 pro-1344 Recombinant Human Killer Cell lectin-like Receptor Subfamily G, Member 1 KLRK1 pro-1290 Recombinant Human Killer Cell lectin-Like Receptor Subfamily K, Member 1 KPNA2 pro-1032 Recombinant Human karyopherin Alpha 2 KPNB1 pro-1001 Recombinant Human karyopherin Beta 1 KRAS pro-854 Recombinant Human Kirsten Rat Sarcoma Viral Oncogene KRT14 pro-348 Recombinant Human Cytokeratin 14 KRT14 His pro-941 Recombinant Human Cytokeratin 14 His Tag KRT18 pro-349 Recombinant Human Cytokeratin 18 KRT18 His pro-484 Recombinant Human Cytokeratin 18 His Tag KRT19 pro-350 Recombinant Human Cytokeratin 19 KRT19 His pro-1347 Recombinant Human Cytokeratin 19 His Tag KRT20 pro-351 Recombinant Human Cytokeratin 20 KRT20 His pro-1358 Recombinant Human Cytokeratin 20 His Tag KRT8 pro-347 Recombinant Human Cytokeratin 8 KRT8 GST pro-298 Recombinant Human Cytokeratin 8 GST-Tag Ku P70/P80 pro-397 Recombinant Human Ku P70/P80 LA/SS-B pro-327 Recombinant Human LA / SS-B LAIR1 pro-431 Recombinant Human Leukocyte-Associated Ig-Like Receptor 1 LAIR2 pro-1081 Recombinant Human Leukocyte-Associated Ig-Like Receptor 2 Lamin-A pro-690 Recombinant Human Lamin-A LAMP2 pro-130 Recombinant Human Lysosomal-Associated Membrane Protein 2 LASP1 pro-1031 Recombinant Human LIM and SH3 Protein 1 LAT pro-948 Recombinant Human Linker for Activation of T Cells LBP pro-538 Recombinant Human Lipopolysaccarid Binding Protein mLBP pro-539 Recombinant Mouse Lipopolysaccarid Binding Protein LDL pro-562 Low Density Lipoprotein LDLRAP1 pro-1033 Recombinant Human Low Density Lipoprotein Receptor Adaptor Protein 1 LDOC1L pro-1153 Recombinant Human Leucine Zipper, Down-Regulated in Cancer 1-Like LEFTY1 pro-962 Recombinant Human Left-Right Determination Factor 1 LGALS10 pro-744 Recombinant Human Charcot-Leyden Crystal Protein LGALSL pro-1374 Recombinant Human Lectin Galactoside-Binding-Like LIN28A pro-743 Recombinant Human LIN28 LIN28B pro-1249 Recombinant Human LIN28B LIN7A pro-1252 Recombinant Human LIN7A LIN7B pro-1298 Recombinant Human LIN7B LIN7C pro-1305 Recombinant Human LIN7C LITAF pro-1350 Recombinant Human Lipopolysaccharide-Induced TNF Factor LLC pro-561 Human Lambda Light Chain LLO pro-320 Recombinant Listeriolysin-O LLO-pest pro-373 Recombinant Listeriolysin-O PEST-free LRG1 pro-141 Human Leucine-Rich Alpha-2-Glycoprotein 1 LRPAP1 pro-1029 pro-151 L-Selectin pro-381 Recombinant Human L-Selectin LSM1 pro-259 Recombinant Human LSM1 Homolog, U6 Small Nuclear RNA Associated LSM12 pro-1329 Recombinant Human LSM12 Homolog, U6 Small Nuclear RNA Associated LSM2 pro-1069 Recombinant Human LSM2 Homolog, U6 Small Nuclear RNA Associated LSM3 pro-1060 Recombinant Human LSM3 Homolog, U6 Small Nuclear RNA Associated LSM4 pro-065 Recombinant Human LSM4 Homolog, U6 Small Nuclear RNA Associated LTF Holo pro-592 Recombinant Human Lactoferrin Holo LYG2 pro-1245 Recombinant Human Lysozyme G-Like 2 LYN pro-136 Recombinant Human v-yes-1 Yamaguchi Sarcoma Viral Related Oncogene M.Pneumoniae pro-795 Recombinant Mycoplasma Pneumoniae P1-N2 M.Pneumoniae pro-801 Recombinant Mycoplasma Pneumoniae P1-C MAD2L1 pro-934 Recombinant Human MAD2 Mitotic Arrest Deficient-Like 1 MAD2L1BP pro-1052 Recombinant Human MAD2L1 Binding Protein MAF1 pro-921 Recombinant Human MAF1 MAFG pro-968 Recombinant Human V-maf Musculoaponeurotic Fibrosarcoma Oncogene G MAFK pro-025 Recombinant Human V-maf Musculoaponeurotic Fibrosarcoma Oncogene K MAGEA1 pro-311 Recombinant Human Melanoma Antigen Family A, 1 MAGEA3 pro-502 Recombinant Human Melanoma Antigen Family A, 3 MAGEA4 pro-843 Recombinant Human Melanoma Antigen Family A, 4 MAGEA5 pro-1070 Recombinant Human Melanoma Antigen Family A, 5 MAGEA6 pro-1113 Recombinant Human Melanoma Antigen Family A, 6 MAGOH pro-810 Recombinant Human Mago-Nashi Homolog MAP1LC3A pro-495 Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 Alpha MAP1LC3B pro-076 Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 Beta MAP1LC3B2 pro-215 Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 Beta 2 MAPKSP1 pro-034 Recombinant Human MAPK Scaffold Protein 1 MAPRE1 pro-058 Recombinant Human Microtubule-Associated Protein, RP/EB Family, Member 1 MAPRE2 pro-932 Recombinant Human Microtubule-Associated Protein, RP/EB Family, Member 2 MAPRE3 pro-264 Recombinant Human Microtubule-Associated Protein, RP/EB Family, Member 3 MAPT pro-295 Recombinant Human Microtubule-Associated Protein Tau MAPT 381a.a. pro-042 Recombinant Human Microtubule-Associated Protein Tau 381 a.a. MAPT 383a.a. pro-012 Recombinant Human Microtubule-Associated Protein Tau 383 a.a. MAPT 412a.a. pro-210 Recombinant Human Microtubule-Associated Protein Tau 412 a.a. MAVS pro-1351 Recombinant Human Mitochondrial Antiviral Signaling Protein MAX pro-811 Recombinant Human MYC Associated Factor X MBD3 pro-1243 Recombinant Human Methyl-CpG Binding Domain Protein 3 MBL2 pro-1285 Recombinant Human Mannose-Binding Lectin 2 MBP pro-616 Recombinant E.Coli Maltose Binding Protein MCFD2 pro-769 Recombinant Human Multiple Coagulation Factor Deficiency 2 MCL1 pro-1202 Recombinant Human Myeloid Cell Leukemia Sequence 1 MCTS1 pro-1387 Recombinant Human Malignant T-Cell-Amplified Sequence 1 MECP2 pro-212 Recombinant Human Methyl CpG Binding Protein 2 MED20 pro-1204 Recombinant Human Mediator Complex Subunit 20 MED4 pro-785 Recombinant Human Mediator Complex Subunit 4 MED7 pro-1319 Recombinant Human Mediator Complex Subunit 7 Melanoma pro-509 Recombinant Human Melanoma (gp100) MEMO1 pro-1148 Recombinant Human Mediator of Cell Motility 1 MESDC2 pro-122 Recombinant Human Mesoderm Development Candidate 2 MET pro-207 Recombinant Human Met Proto-Oncogene MET, GST pro-497 Recombinant Human Met Proto-Oncogene, GST Tag MFAP2 pro-1265 Recombinant Human Microfibrillar-associated Protein 2 MFAP4 pro-1210 Recombinant Human Microfibrillar-associated Protein 4 MGP pro-922 Recombinant Human Matrix Gla Protein MICA pro-367 Recombinant Human MHC class I chain-related gene A MICB pro-368 Recombinant Human MHC class I chain-related gene B MIS12 pro-022 Recombinant Human MIS12 MLF1 pro-100 Recombinant Human Myeloid Leukemia Factor 1 MMACHC pro-1119 Recombinant Human Methylmalonic Aciduria cblC type, with Homocystinuria MNDA pro-763 Recombinant Human Myeloid Cell Nuclear Differentiation Antigen MOBKL1B pro-068 Recombinant Human MOB1, Mps One Binder Kinase Activator-Like 1B MOBLK3 pro-049 Recombinant Human MOB1, Mps One Binder Kinase Activator-Like 3 MOCS2 pro-1281 Recombinant Human Molybdenum Cofactor Synthesis 2 MOG pro-371 Myelin Oligodendrocyte Glycoprotein MOG pro-466 Recombinant Human Myelin Oligodendrocyte Glycoprotein MORF4L1 pro-1078 Recombinant Human Mortality Factor 4 Like 1 MORF4L2 pro-475 Recombinant Human Mortality Factor 4 Like 2 MRAS pro-1008 Recombinant Human Muscle RAS Oncogene Homolog MRM1 pro-1416 Recombinant Human Mitochondrial RRNA Methyltransferase 1 MRRF pro-1299 Recombinant Human Mitochondrial Ribosome Recycling Factor MRTO4 pro-1233 Recombinant Human mRNA Turnover 4 MRPL28 pro-1279 Recombinant Human Mitochondrial Ribosomal Protein L28 MRPL13 pro-1404 Recombinant Human Mitochondrial Ribosomal Protein L13 MSH6 pro-745 Recombinant Human MutS Homolog 6 MXD3 pro-1356 Recombinant Human MAX Dimerization Protein 3 MUTED pro-1155 Recombinant Human MUTED MYC pro-087 Recombinant Human V-Myc Myelocytomatosis Viral Oncogene MYCBP pro-942 Recombinant Human C-Myc Binding Protein MYD88 pro-1377 Recombinant Human Myeloid Differentiation Primary Response 88 MYL1 pro-365 Recombinant Human Myosin Light Chain 1 MYL12A pro-902 Recombinant Human Myosin Light Chain 12A MYL12B pro-1124 Recombinant Human Myosin Light Chain 12B MYL2 pro-524 Recombinant Human Myosin Light Chain 2 MYL4 pro-992 Recombinant Human Myosin Light Chain 4 MYL5 pro-916 Recombinant Human Myosin Light Chain 5 MYL5 (1-173 a.a.) pro-943 Recombinant Human Myosin Light Chain 5 (1-173 a.a.) MYL6 pro-171 Recombinant Human Myosin Light Chain 6 MYL6B pro-964 Recombinant Human Myosin Light Chain 6B MYL7 pro-1109 Recombinant Human Myosin Light Chain 7 MYL9 pro-107 Recombinant Human Myosin Light Chain 9 MYLPF pro-243 Recombinant Human Myosin Light chain, Phosphorylatable, Fast Skeletal Muscle Myoglobin pro-336 Recombinant Human Myoglobin Myoglobin pro-565 Human Myoglobin Myoglobin heme free pro-374 Recombinant Human Myoglobin Heme free Myoglobin His pro-071 Recombinant Human Myoglobin, His Tag NACA pro-974 Recombinant Human Nascent Polypeptide-Associated Complex Alpha NANOG pro-896 Recombinant Human Nanog NANOG, His pro-881 Recombinant Human Nanog, His Tag NANOG-TAT pro-090 Recombinant Human Nanog-TAT NAP1L1 pro-985 Recombinant Human Nucleosome Assembly Protein 1-Like 1 NAPA pro-250 Recombinant Human N-Ethylmaleimide-Sensitive Factor Attachment Protein, Alpha NAPG pro-944 Rcombinant Human N-ethylmaleimide-Sensitive Factor Attachment Protein, Gamma NBL1 pro-1365 Recombinant Human Neuroblastoma 1 NCALD pro-093 Recombinant Human Neurocalcin Delta NCBP2 pro-265 Recombinant Human Nuclear Cap Binding Protein Subunit 2 NCEH1 pro-1393 Recombinant Human Neutral Cholesterol Ester Hydrolase 1 NCF1 pro-488 Recombinant Human Neutrophil Cytosolic Factor 1 NCF4 pro-1258 Recombinant Human Neutrophil Cytosolic Factor 4 NCK1 pro-839 Recombinant Human NCK Adaptor Protein 1 NCS1 pro-802 Recombinant Human Neuronal Calcium Sensor 1 NDE1 pro-204 Recombinant Human nudE Nuclear Distribution Gene E Homolog 1 NDRG1 pro-724 Recombinant Human N-Myc Downstream Regulated 1 NDRG2 pro-1198 Recombinant Human N-Myc Downstream Regulated 2 NECAP2 pro-180 Recombinant Human NECAP Endocytosis Associated 2 NFKBIA pro-960 Recombinant Human NF-kappa-B Inhibitor Alpha NFKBIB pro-1046 Recombinant Human NF-kappa-B Inhibitor Beta NHEJ1 pro-1193 Recombinant Human Nonhomologous End-Joining Factor 1 NHP2 pro-067 Recombinant Human NHP2 Ribonucleoprotein Homolog NHP2L1 pro-038 Recombinant Human NHP2 Non-Histone Chromosome Protein 2-Like NIP7 pro-780 Recombinant Human Nuclear Import 7 Homolog NKIRAS1 pro-1039 Recombinant Human NFKB Inhibitor Interacting Ras-Like 1 NKIRAS2 pro-1091 Recombinant Human NFKB Inhibitor Interacting Ras-Like 2 NKp46 pro-432 Recombinant Human Natural Cytotoxicity Receptor NKp46 NKX3-1 pro-1341 Recombinant Human NK3 Homeobox 1 NME1 pro-715 Recombinant Human Non-Metastatic Cells 1 NME3 pro-082 Recombinant Human Non-Metastatic Cells 3 NME4 pro-219 Recombinant Human Non-Metastatic Cells 4 NMI pro-070 Recombinant Human N-Myc Interactor NMM pro-366 Recombinant Human Non-Muscle Myosin-II Regulatory Light Chain NMRAL1 pro-1131 Recombinant Human NmrA-Like Family Domain Containing 1 NOL3 pro-1178 Recombinant Human Nucleolar Protein 3 6 pro-1340 Recombinant Human 6 NPM1 pro-1120 Recombinant Human Nucleophosmin NPM2 pro-1182 Recombinant Human Nucleophosmin 2 NR1H2 pro-869 Recombinant Human Nuclear Receptor Subfamily 1 Group H, Member 2 NRAS pro-794 Recombinant Human Neuroblastoma RAS Viral Oncogene Homolog NRIP3 pro-1384 Recombinant Human Nuclear Receptor-Interacting Protein 3 NTAL pro-827 Recombinant Human Non-T-cell Activation Linker NTS pro-1311 Recombinant Human Neurotensin NUCB2 pro-492 Recombinant Human Nucleobindin-2 NUCB2, His pro-142 Recombinant Human Nucleobindin-2, His Tag mNUCB2 pro-605 Recombinant Mouse Nucleobindin-2 NUP210 pro-109 Recombinant Human Nucleopurin 210kDa NUP62 pro-999 Recombinant Human Nucleopurin 62kDa NusA pro-623 Recombinant E.Coli Transcription Termination/Antitermination L Factor NUTF2 pro-844 Recombinant Human Nuclear Transport Factor 2 NXT1 pro-218 Recombinant Human NTF2-like Export Factor 1 NXT2 pro-1051 Recombinant Human NTF2-like Export Factor 2 NY-ESO-1 pro-531 Recombinant Human New York Esophageal Squamous Cell Carcinoma OAZ1 pro-1200 Recombinant Human Ornithine Decarboxylase Antizyme 1 OBFC1 pro-028 Recombinant Human Oligonucleotide Binding Fold Containing 1 OCM pro-143 Recombinant Human Oncomodulin-1 OLR1 pro-923 Recombinant Human Oxidized Low Density Lipoprotein Receptor 1 OMP pro-1412 Recombinant Human Olfactory Marker Protein Omp Pylori pro-369 Recombinant Helicobacter Pylori Outer Membrane Protein OmpA pro-571 Recombinant Bacterial Outer Membrane Protein-A ORAOV1 pro-1092 Recombinant Human Oral Cancer Overexpressed 1 ORM1 pro-889 Recombinant Human Orosomucoid 1 Osteocrin pro-420 Recombinant Human Osteocrin OTUB1 pro-711 Recombinant Human Ubiquitin Aldehyde Binding 1 OTUB2 pro-214 Recombinant Human Ubiquitin Aldehyde Binding 2 OVCA2 pro-1123 Recombinant Human Ovarian Tumor Suppressor Candidate 2 p53 pro-742 Recombinant Human p53 p53 Mutant pro-301 Recombinant Human p53 Mutant PA2G4 pro-782 Recombinant Human Proliferation-associated protein 2G4 PAEP pro-1397 Recombinant Human Progesterone-Associated Endometrial Protein PAIP2 pro-748 Recombinant Human Polyadenylate-Binding Protein-Interacting Protein 2 PARD6B pro-1307 Recombinant Human Par-6 Partitioning Defective 6 Homolog Beta PARK7 pro-575 Recombinant Human Parkinson Disease Protein 7 PARVA pro-1257 Recombinant Human Parvin Alpha PBLD pro-010 Recombinant Human Phenazine Biosynthesis-Like Protein Domain Containing pCD163 pro-856 Recombinant Porcine CD163 PCNA pro-615 Recombinant Human Proliferating Cell Antigen PCNA GST pro-741 Recombinant Human Proliferating Cell Antigen, GST Tag PCNA Sf9 pro-303 Recombinant Human Proliferating Cell Antigen, S9 PCNP pro-906 Recombinant Human PEST proteolytic Signal Containing Nuclear Protein PDAP1 pro-490 Recombinant Human PDGFA Associated Protein 1 PDCD4 pro-606 Recombinant Human ProgrammedCell Death 4 PDCD5 pro-624 Recombinant Human Programmed Cell Death 5 PDCD6 pro-184 Recombinant Human Programmed Cell Death 6 PDCD6IP pro-792 Recombinant Human ProgrammedCell Death 6 Interacting Protein PDCL pro-1141 Recombinant Human Phosducin-Like PDCL3 pro-1028 Recombinant Human Phosducin-Like 3 PDPN pro-626 Recombinant Human Podoplanin PDRG1 pro-007 Recombinant Human p53 and DNA-Damage Regulated 1 PDZD11 pro-1263 Recombinant Human PDZ Domain Containing 11 PEA15 pro-729 Recombinant Human Phosphoprotein Enriched in Astrocytes 15 PEBP1 pro-722 Recombinant Human Phosphatidylethanolamine Binding Protein 1 PEF1 pro-099 Recombinant Human Penta-EF-Hand Domain Containing 1 PEX pro-360 Recombinant Human C-terminal hemopexin-like domain of MMP-2 (445-635 a.a.) PEX19 pro-925 Recombinant Human Peroxisomal Biogenesis Factor 19 PFDN1 pro-277 Recombinant Human Prefoldin Subunit 1 PFDN2 pro-001 Recombinant Human Prefoldin Subunit 2 PFDN4 pro-092 Recombinant Human Prefoldin Subunit 4 PFDN5 pro-901 Recombinant Human Prefoldin Subunit 5 PFDN6 pro-178 Recombinant Human Prefoldin Subunit 6 PFN1 pro-528 Recombinant Human Profilin-1 PFN2 pro-809 Recombinant Human Profilin-2 PFN4 pro-818 Recombinant Human Profilin-4 PGP9.5 pro-576 Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase L1 PGP9.5 GST pro-304 Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase L1 GST tag PGR pro-535 Recombinant Human Progesterone Receptor PHB pro-1381 Recombinant Human Prohibitin PHF11 pro-1268 Recombinant Human PHD Finger Protein 11 PHLDA2 pro-781 Recombinant Human Pleckstrin Homology-Like Domain Family A Member 2 PIM1 pro-1389 Recombinant Human PIM1 PINX1 pro-693 Recombinant Human PIN2-Interacting Protein 1 PIR pro-1040 Recombinant Human Pirin PITPNA pro-044 Recombinant Human Phosphatidylinositol Transfer Protein, Alpha PITPNB pro-003 Recombinant Human Phosphatidylinositol Transfer Protein, Beta PLDN pro-1068 Recombinant Human Pallidin Homolog PLSCR1 pro-1271 Recombinant Human Phospholipid Scramblase 1 PMP2 pro-651 Recombinant Human Peripheral Myelin Protein-2 PMP2 His pro-671 Recombinant Human Peripheral Myelin Protein-2, His Tag POLR2J pro-1260 Recombinant Human Polymerase (RNA) III (DNA directed) Polypeptide J POLR3H pro-1250 Recombinant Human Polymerase (RNA) III (DNA directed) Polypeptide H POMC pro-236 Recombinant Human Proopiomelanocortin POP4 pro-1407 Recombinant Human Processing Of Precursor 4 POU2AF1 pro-880 Recombinant Human POU class 2 associating factor 1 POU5F1 pro-088 Recombinant Human POU Class 5 Homeobox 1 POU5F1 PolyR pro-091 Recombinant Human POU Class 5 Homeobox 1 Polyarginine-Tag PQBP1 pro-1101 Recombinant Human Polyglutamine Binding Protein 1 Prealbumin pro-771 Recombinant Human Transthyretin Prelamin-A pro-689 Recombinant Prelamin-A PRND pro-018 Recombinant Human Prion Protein 2 PRNP pro-1400 Recombinant Human Prion Protein PROC pro-485 Recombinant Human Protein-c Protein-A/G pro-646 Recombinant Protein A/G Protein-G pro-402 Recombinant Protein G Protein-G His pro-1237 Recombinant Protein G His Tag Prothrombin pro-439 Human Prothrombin Complex P-Selectin pro-382 Recombinant Human P-Selectin PSMA pro-740 Recombinant Human Prostate Specific Membrane Antigen PSMB10 pro-931 Recombinant Human Proteasome Beta Type 10 PSME1 pro-266 Recombinant Human Proteasome Activator Subunit 1 PSME2 pro-975 Recombinant Human Proteasome Activator Subunit 2 PSME3 pro-987 Recombinant Human Proteasome Activator Subunit 3 PSMG2 pro-930 Recombinant Human Proteasome Assembly Chaperone 2 PSMG3 pro-261 Recombinant Human Proteasome Assembly Chaperone 3 PSMG4 pro-989 Recombinant Human Proteasome Assembly Chaperone 4 PSP94 pro-598 Recombinant Human Beta-Microseminoprotein PTEN pro-305 Recombinant Human Phosphatase and Tensin Homolog PTEN His pro-712 Recombinant Human Phosphatase and Tensin homolog His Tag PTGDS pro-316 Recombinant Human Beta-Trace pThrombin pro-617 Porcine Thrombin pTrypsin pro-787 Recombinant Porcine Trypsin PTTG1 pro-717 Recombinant Human Pituitary Tumor-Transforming Protein 1 PTX3 pro-694 Recombinant Human Pentraxin-3 PVALB pro-004 Recombinant Human Parvalbumin RAB10 pro-1361 Recombinant Human RAB10, Member RAS Oncogene Family RAB11A pro-826 Recombinant Human RAB11A, Member RAS Oncogene Family RAB13 pro-882 Recombinant Human RAB13, Member RAS Oncogene Family RAB14 pro-873 Recombinant Human RAB14, Member RAS Oncogene Family RAB17 pro-874 Recombinant Human RAB17, Member RAS Oncogene Family RAB18 pro-976 Recombinant Human RAB18, Member RAS Oncogene Family RAB1A pro-097 Recombinant Human RAB1A, Member RAS Oncogene Family RAB1B pro-045 Recombinant Human RAB1B, Member RAS Oncogene Family RAB21 pro-101 Recombinant Human RAB21, Member RAS Oncogene Family RAB22A pro-929 Recombinant Human RAB22, Member RAS Oncogene Family RAB23 pro-977 Recombinant Human RAB23, Member RAS Oncogene Family RAB24 pro-951 Recombinant Human RAB24, Member RAS Oncogene Family RAB27A pro-825 Recombinant Human RAB27A, Member RAS Oncogene Family RAB27B pro-075 Recombinant Human RAB27B, Member RAS Oncogene Family RAB2A pro-244 Recombinant Human RAB2A, Member RAS Oncogene Family RAB2B pro-1013 Recombinant Human RAB2B, Member RAS Oncogene Family RAB31 pro-1090 Recombinant Human RAB31, Member RAS Oncogene Family RAB32 pro-950 Recombinant Human RAB32, Member RAS Oncogene Family RAB34 pro-978 Recombinant Human RAB34, Member RAS Oncogene Family RAB35 pro-935 Recombinant Human RAB35, Member RAS Oncogene Family RAB3A pro-870 Recombinant Human RAB3A, Member RAS Oncogene Family RAB3B pro-875 Recombinant Human RAB3B, Member RAS Oncogene Family RAB3D pro-247 Recombinant Human RAB3D, Member RAS Oncogene Family RAB4A pro-871 Recombinant Human RAB4A, Member RAS Oncogene Family RAB5A pro-590 Recombinant Human RAB5A, Member RAS Oncogene Family RAB5B pro-056 Recombinant Human RAB5B, Member RAS Oncogene Family RAB6A pro-047 Recombinant Human RAB6A, Member RAS Oncogene Family RAB6B pro-103 Recombinant Human RAB6B, Member RAS Oncogene Family RAB7A pro-077 Recombinant Human RAB7A, Member RAS Oncogene Family RABIF pro-300 Recombinant Human RAB Interacting Factor RAC1 pro-572 Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1 RAC1 His pro-731 Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1 His Tag RAC2 pro-619 Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 2 RAC2 (189) pro-719 Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 2 (1-189) RAC3 pro-073 Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 3 RAD1 pro-868 Recombinant Human RAD1 RAET1E pro-1293 Recombinant Human Retinoic Acid Early Transcript 1E RALA pro-043 Recombinant Human V-ral Simian Leukemia Viral Oncogene Homolog A RALB pro-053 Recombinant Human V-ral Simian Leukemia Viral Oncogene Homolog B RAMP3 pro-1367 Recombinant Human Receptor Activity-Modifying Protein 3 RAN pro-841 Recombinant Human RAN, Member RAS Oncogene Family RANBP1 pro-1064 Recombinant Human RAN Binding Protein 1 RANGRF pro-1149 Recombinant Human RAN Guanine Nucleotide Release Factor RAP1A pro-848 Recombinant Human RAP1A, Member RAS Oncogene Family RAP1B pro-083 Recombinant Human RAP1B, Member RAS Oncogene Family RAP2B pro-1364 Recombinant Human RAP2B, Member RAS Oncogene Family RAP2A pro-061 Recombinant Human RAP2A, Member RAS Oncogene Family RARA pro-596 Recombinant Retnoid Acid Receptor Alpha RARRES2 pro-788 Recombinant Human Retinoic Acid Receptor Responder 2 RASSF1A pro-1288 Recombinant Human Ras association domain-containing protein 1 RASSF3 pro-1378 Recombinant Human Ras Association Domain-Containing Protein 3 RB1 pro-584 Recombinant Human Retinoblastoma Associated Protein RBBP4 pro-1168 Recombinant Human Retinoblastoma Binding Protein 4 RBBP9 pro-991 Recombinant Human Retinoblastoma Binding Protein 9 RBM8A pro-186 Recombinant Human RNA Binding Motif Protein 8A rCALB1 pro-400 Recombinant Rat Calbindin-1 RCAN1 pro-319 Recombinant Human Regulator of Calcineurin 1 RCAN2 pro-990 Recombinant Human Regulator of Calcineurin 2 RCAN3 pro-1284 Recombinant Human Regulator of Calcineurin 3 RCN1 pro-544 Recombinant Human Reticulocalbin 1 RCN2 pro-189 Recombinant Human Reticulocalbin 2 RCN3 pro-1049 Recombinant Human Reticulocalbin 3 RCVRN pro-441 Recombinant Human Recoverin RDBP pro-181 Recombinant Human RD RNA Binding Protein REG1A pro-289 Recombinant Human Regenerating Islet-Derived 1 Alpha REG1B pro-391 Recombinant Human Regenerating Islet-Derived 1 Beta REG3A pro-421 Recombinant Human Regenerating Islet-Derived 3 Alpha REG4 pro-424 Recombinant Human Regenerating Islet-Derived 4 RERG pro-106 Recombinant Human RAS-like, Estrogen-Regulated, Growth Inhibitor rFibronectin pro-131 Rat Fibronectin rGFP pro-687 Recombinant Green Fluorescent Protein RGN pro-915 Recombinant Human Regucalcin RGS1 pro-1118 Recombinant Human Regulator of G-Protein Signaling 1 RGS10 pro-890 Recombinant Human Regulator of G-Protein Signaling 10 RGS14 pro-1151 Recombinant Human Regulator of G-Protein Signaling 14 RGS16 pro-798 Recombinant Human Regulator of G-Protein Signaling 16 RGS17 pro-924 Recombinant Human Regulator of G-Protein Signaling 17 RGS19 pro-037 Recombinant Human Regulator of G-Protein Signaling 19 RGS2 pro-182 Recombinant Human Regulator of G-Protein Signaling 2 RGS21 pro-898 Recombinant Human Regulator of G-Protein Signaling 21 RGS4 pro-900 Recombinant Human Regulator of G-Protein Signaling 4 RGS5 pro-905 Recombinant Human Regulator of G-Protein Signaling 5 RHEB pro-308 Recombinant Human Ras Homolog Enriched in Brain RHOA pro-057 Recombinant Human Ras Homolog Gene Family Member A RHOB pro-224 Recombinant Human Ras Homolog Gene Family Member B RHOC pro-865 Recombinant Human Ras Homolog Gene Family Member C RHOD pro-190 Recombinant Human Ras Homolog Gene Family Member D RHOG pro-1136 Recombinant Human Ras Homolog Gene Family Member G RHOV pro-1199 Recombinant Human Ras Homolog Gene Family Member V rHSA HEK pro-967 Recombinant Human Serum Albumin, HEK rHSA Plant pro-595 Recombinant Human Serum Albumin, Plant RLN2 pro-1327 Recombinant Human Relaxin-2 rmS100b pro-1236 Recombinant Rhesus Macaque S100 Calcium Binding Protein B RND1 pro-893 Recombinant Human Rho Family GTPase 1 RND3 pro-487 Recombinant Human Rho Family GTPase 3 RNF181 pro-1218 Recombinant Human Ring Finger Protein 181 RNF4 pro-1255 Recombinant Human Ring Finger Protein 4 ROBLD3 pro-050 Recombinant Human Roadblock Domain Containing 3 RORC pro-206 Recombinant Human RAR-Related Orphan Receptor C RP9 pro-1314 Recombinant Human Retinitis Pigmentosa 9 RPA2 pro-011 Recombinant Human Replication Protein A2 RPL26L1 pro-1242 Recombinant Human Ribosomal Protein L26-Like 1 RPL8 pro-1053 Recombinant Human Ribosomal Protein L8 RPLP0 pro-392 Recombinant Human Ribosomal Phosphoprotein P0 RPLP1 pro-127 Recombinant Human Ribosomal Phosphoprotein P1 RPLP2 pro-128 Recombinant Human Ribosomal Phosphoprotein P2 RPS3 pro-954 Recombinant Human Ribosomal Protein S3 RPS3A pro-1125 Recombinant Human Ribosomal Protein S3A RPS5 pro-1300 Recombinant Human Ribosomal Protein S5 RPS7 pro-993 Recombinant Human Ribosomal Protein S7 RPS10 pro-1409 Recombinant Human Ribosomal Protein S10 RPS14 pro-118 Recombinant Human Ribosomal Protein S14 rPVALB pro-398 Recombinant Rat Parvalbumin RQCD1 pro-008 Recombinant Human RCD1 Required for Cell Differentiation1 RRAGC pro-1050 Recombinant Human Ras-Related GTP Binding C rRAP pro-352 Recombinant Rat Receptor Associated Protein RRAS pro-808 Recombinant Human Related RAS Viral (r-ras) Oncogene Homolog RRAS2 pro-728 Recombinant Human Related RAS Viral (r-ras) Oncogene Homolog 2 rSCGN pro-657 Recombinant Rat Secretagogin RSG1 pro-1334 Recombinant Human REM2 and RAB-Like Small GTPase 1 RTN4IP1 pro-1014 Recombinant Human Reticulon 4 Interacting Protein 1 rTpc1808 pro-587 Recombinant Rat Tropic 1808 rTroponin-C pro-323 Rabbit Skeletal Muscle Troponin-C RUNX3 pro-836 Recombinant Human Runt-Related Transcription Factor 3 RUVBL1 pro-861 Recombinant Human RuvB-Like 1 rVCAM1 pro-361 Recombinant Rabbit Vascular cell adhesion molecule 1 RWDD1 pro-1309 Recombinant Human RWD Domain Containing 1 RXRA pro-437 Recombinant Human Retinoid X Receptor Alpha RYBP pro-1139 Recombinant Human RING1 & YY1 Binding Protein S100A1 pro-364 Recombinant Human S100 Calcium Binding Protein A1 mS100A1 pro-237 Recombinant Mouse S100 Calcium Binding Protein A1 S100A10 pro-384 Recombinant Human S100 Calcium Binding Protein A10 S100A11 pro-385 Recombinant Human S100 Calcium Binding Protein A11 S100A12 pro-152 Recombinant Human S100 Calcium Binding Protein A12 S100A13 pro-153 Recombinant Human S100 Calcium Binding Protein A13 S100A14 pro-154 Recombinant Human S100 Calcium Binding Protein A14 S100A16 pro-155 Recombinant Human S100 Calcium Binding Protein A16 S100A2 pro-146 Recombinant Human S100 Calcium Binding Protein A2 S100A3 pro-755 Recombinant Human S100 Calcium Binding Protein A3 mS100A3 pro-1166 Recombinant Mouse S100 Calcium Binding Protein A3 S100A4 pro-307 Recombinant Human S100 Calcium Binding Protein A4 S100A4 His pro-698 Recombinant Human S100 Calcium Binding Protein A4 His Tag mS100A4 pro-229 Recombinant Mouse S100 Calcium Binding Protein A4 S100A5 pro-147 Recombinant Human S100 Calcium Binding Protein A5 mS100A5 pro-1084 Recombinant Mouse S100 Calcium Binding Protein A5 S100A6 pro-148 Recombinant Human S100 Calcium Binding Protein A6 mS100A6 pro-409 Mouse S100 Calcium Binding Protein A6 mS100A6 pro-240 Recombinant Mouse S100 Calcium Binding Protein A6 S100A7 pro-149 Recombinant Human S100 Calcium Binding Protein A7 S100A7A pro-756 Recombinant Human S100 Calcium Binding Protein A7A S100A8 pro-800 Recombinant Human S100 Calcium Binding Protein A8 S100A8, His pro-150 Recombinant Human S100 Calcium Binding Protein A8, His Tag mS100A8 pro-233 Recombinant Mouse S100 Calcium Binding Protein A8 S100A9 pro-814 Recombinant Human S100 Calcium Binding Protein A9 S100A9, His pro-151 Recombinant Human S100 Calcium Binding Protein A9, His Tag mS100A9 pro-878 Recombinant Mouse S100 Calcium Binding Protein A9 S100b pro-306 Recombinant Human S100 Calcium Binding Protein B mS100b pro-853 Recombinant Mouse S100 Calcium Binding Protein B S100b GST pro-737 Recombinant Human S100 Calcium Binding Protein B, GST Tag S100G pro-399 Recombinant Rat S100 Calcium Binding Protein G S100G pro-156 Recombinant Human S100 Calcium Binding Protein G S100P pro-425 Recombinant Human S100 Calcium Binding Protein P S100P His pro-830 Recombinant Human S100 Calcium Binding Protein P, His Tag S100Z pro-840 Recombinant HumanS100 Calcium Binding Protein Z mS100A15 pro-1145 Recombinant Mouse S100 Calcium Binding Protein A15 SAMD13 pro-355 Recombinant Human Sterile Alpha Motif Domain Containing 13 SAP18 pro-707 Recombinant Human Sin3A-Associated Protein, 18kDa SAR1A pro-709 Recombinant Human GTP-Binding Protein SAR1A SAR1B pro-310 Recombinant Human GTP-Binding Protein SAR1B SBDS pro-272 Recombinant Human Shwachman-Bodian-Diamond Syndrome SCAND1 pro-269 Recombinant Human SCAN domain containing 1 SCG5 pro-467 Recombinant Human Secretogranin V SCGB2A2 pro-515 Recombinant Human Mammaglobin-A SCGN pro-599 Recombinant Human Secretagogin SCO2 pro-054 Recombinant Human SCO Cytochrome Oxidase Deficient Homolog 2 SDC1 pro-1065 Recombinant Human Syndecan-1 SDC1, GST pro-516 Recombinant Human Syndecan-1, GST tag SDC4 pro-778 Recombinant Human Syndecan-4 SDC4, His pro-583 Recombinant Human Syndecan-4, His Tag SDCBP pro-036 Recombinant Human Syndecan Binding Protein SDCBP2 pro-1297 Recombinant Human Syndecan Binding Protein 2 SDHAF2 pro-593 Recombinant Human Succinate Dehydrogenase Complex Assembly Factor 2 SDR16C5 pro-1385 Recombinant Human Short Chain Dehydrogenase/Reductase Family 16C, Member 5 SEC13 pro-194 Recombinant Human SEC13 SEC22B pro-1212 Recombinant Human SEC22 Homolog B SecB pro-697 Recombinant Protein Export Protein SecB SEPT2 pro-255 Recombinant Human Septin-2 SEPT5 pro-879 Recombinant Human Septin-5 SEPT6 pro-949 Recombinant Human Septin-6 SEPX1 pro-260 Recombinant Human Selenoprotein X 1 SERPINA1 pro-456 Human Alpha-1 Antitrypsin SERPINA1 pro-529 Recombinant Human Alpha-1 Antitrypsin SERPINA1, Active pro-907 Recombinant Human Alpha-1 Antitrypsin, Active SERPINA3 pro-750 Recombinant Human Alpha-1 AntiChymotrypsin SERPINA3 pro-378 Human Alpha-1 AntiChymotrypsin SERPINA5 pro-749 Recombinant Human Serpin Peptidase Inhibitor, Clade A Member 5 SERPINB5 pro-202 Recombinant Human Serpin Peptidase Inhibitor, Clade B Member 5 SERPINB5 His pro-704 Recombinant Human Serpin Peptidase Inhibitor, Clade B Member 5, His Tag SERPING1 pro-1401 Recombinant Human Serpin Peptidase Inhibitor, Clade G Member 1 SERPINI1 pro-213 Recombinant Human Serpin Peptidase Inhibitor, Clade I Member 1 SERTAD1 pro-1157 Recombinant Human SERTA Domain Containing 1 SF3B14 pro-105 Recombinant Human Splicing Factor 3B, 14 kDa Subunit SGCD pro-1373 Recombinant Human Sarcoglycan Delta SGTA pro-807 Recombinant Human Small Glutamine-Rich Tetratricopeptide Repeat-Containing Protein Alpha SH2D1A pro-006 Recombinant Human SH2 domain containing 1A SH3BGRL pro-1159 Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like SH3BGRL2 pro-1215 Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like 2 SH3BGRL3 pro-1216 Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like 3 SH3GL2 pro-1083 Recombinant Human SH3-domain GRB2-like 2 SH3GLB1 pro-1278 Recombinant Human SH3-domain GRB2-like endophilin B1 SH3GLB2 pro-1287 Recombinant Human SH3-domain GRB2-like endophilin B2 SHC1 pro-883 Recombinant Human SHC-Transforming Protein 1 SIL1 pro-1187 Recombinant Human SIL1 SIRT2 pro-033 Recombinant Human SIrtuin-2 SIRT3 pro-462 Recombinant Human SIrtuin-3 SIRT6 pro-282 Recombinant Human SIrtuin-6 SIT1 pro-928 Recombinant Human Signaling Threshold Regulating Transmembrane Adaptor 1 SIX1 pro-1226 Recombinant Human SIX Homeobox 1 SIX6 pro-1253 Recombinant Human SIX Homeobox 6 SLAMF1 pro-1342 Recombinant Human SLAMF1 SLAMF6 pro-1286 Recombinant Human SLAMF6 SLC4A4 pro-688 Recombinant Human Solute Carrier Family 4, Sodium Bicarbonate Cotransporter, Member 4 SLPI pro-849 Recombinant Human Secretory Leukocyte Peptidase Inhibitor SMAC/DIABLO pro-614 Recombinant Human SMAC/DIABLO SMAD2 pro-691 Recombinant Human SMAD Family Member 2 SMAD3 pro-751 Recombinant Human Mothers Against Decapentaplegic Homolog 3 SMAD4 pro-459 Recombinant Human Mothers Against Decapentaplegic Homolog 4 SMNDC1 pro-035 Recombinant Human Survival Motor Neuron Domain Containing 1 SNAP23 pro-659 Recombinant Human Synaptosomal-associated protein 23kDa SNAP25 pro-573 Recombinant Human Synaptosomal-associated protein 25kDa SNAP-25 pro-396 Recombinant Synaptosomal-associated protein 25kDa, C.elegans SNAP25B pro-635 Recombinant Human Synaptosomal-associated protein 25B SNAPIN pro-663 Recombinant Human SNAP Associated Protein SNCA pro-393 Recombinant Human Alpha-Synuclein SNCA 1-60 pro-165 Recombinant Human Alpha-Synuclein 1-60 SNCA 61-140 pro-163 Recombinant Human Alpha-Synuclein 61-140 SNCA 96-140 pro-164 Recombinant Human Alpha-Synuclein 96-140 SNCA A30P pro-158 Recombinant Human Alpha-Synuclein A30P SNCA A30P/A53T pro-160 Recombinant Human Alpha-Synuclein A30P/A53T SNCA A53T pro-159 Recombinant Human Alpha-Synuclein A53T SNCA Delta-NAC pro-161 Recombinant Human Alpha-Synuclein Delta-NAC SNCA NACP112 pro-162 Recombinant Human Alpha-Synuclein NACP112 CA pro-858 Recombinant Mouse Alpha-Synuclein SNCB pro-394 Recombinant Human Beta-Synuclein SNCG pro-395 Recombinant Human Gamma-Synuclein SNF8 pro-1135 Recombinant Human SNF8, ESCRT-II Complex Subunit SNIP1 pro-201 Recombinant Human Smad Nuclear Interacting Protein 1 SNPH pro-545 Recombinant Human Syntaphilin SNRNP25 pro-226 Recombinant Human Small Nuclear Ribonucleoprotein 25kDa SNRNP70 pro-445 Recombinant Human Small Nuclear Ribonucleoprotein 70kDa SNRPA1 pro-1015 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide A SNRPB2 pro-217 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide B SNRPC pro-1004 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide C SNRPD pro-997 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D1, D2, D3 SNRPD1 pro-994 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D1 SNRPD2 pro-123 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D2 SNRPD2, Sf9 pro-995 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D2, Sf9 SNRPD3 pro-945 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D3 SNRPD3, Sf9 pro-996 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D3, Sf9 SNRPE pro-104 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide E SNRPF pro-041 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide F SNRPG pro-196 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide G SNTA1 pro-1016 Recombinant Human Syntrophin, Alpha 1 SNTN pro-216 Recombinant Human Sentan Cilia Apical Structure Protein SNUPN pro-866 Recombinant Human Snurportin 1 SNX1 pro-665 Recombinant Human Sorting Nexin 1 SNX3 pro-246 Recombinant Human Sorting Nexin 3 SOD pro-286 Recombinant Human Superoxide Dismutase SOD His pro-1239 Recombinant Human Superoxide Dismutase His Tag SOD1 pro-648 Recombinant Human Superoxide Dismutase-1 SOD2 pro-819 Recombinant Human Superoxide Dismutase-2 SODA pro-208 Recombinant E.Coli Superoxide Dismutase SOSTDC1 pro-426 Recombinant Human Sclerostin Domain Containing 1 SOX2 pro-820 Recombinant Human SRY (sex determining region Y)-box 2 SOX2 PolyR pro-089 Recombinant Human SRY (sex determining region Y)-box 2 Polyarginine-Tag Sox2-TAT pro-1343 Recombinant Human SRY (sex determining region Y)-box 2 TAT SOX9 pro-739 Recombinant Human SOX9 SP100 pro-108 Recombinant Human SP100 SPA pro-356 Recombinant Staphylococcal Protein-A SPA 41kDa pro-774 Recombinant Staphylococcal Protein-A 41kDa SPA 434a.a. pro-686 Recombinant Staphylococcal Protein A 434 a.a SPARC pro-582 Recombinant Human Secreted Protein Acidic & Rich in Cysteine SPG21 pro-677 Recombinant Human Spastic Paraplegia 21 SPIN1 pro-1184 Recombinant Human Spindlin-1 SPINT pro-1296 Recombinant Human Serine Peptidase Inhibitor, Kunitz Type 2 SPOP pro-195 Recombinant Human Speckle-Type POZ Protein SPSB1 pro-223 Recombinant Human SPRY Domain-Containing SOCS Cox Protein 1 SPSB2 pro-1264 Recombinant Human SPRY Domain-Containing SOCS Cox Protein 2 SQSTM1 pro-806 Recombinant Human Sequestosome 1 SRA1 pro-1274 Recombinant Human Steroid Receptor RNA Activator 1 sRAGE pro-600 Recombinant Human Advanced Glycosylation End Product-Specific Receptor sRAGE HEK pro-601 Recombinant Human Advanced Glycosylation End Product-Specific Receptor, HEK SRSF1 pro-1352 Recombinant Human Serine/arginine-Rich Splicing Factor 1 SRGN pro-965 Recombinant Human Serglycin SRI pro-166 Recombinant Human Sorcin SRP14 pro-013 Recombinant Human Signal Recognition Particle 14kDa SRP54 pro-113 Recombinant Human Signal Recognition Particle 54kDa SSBP1 pro-1408 Recombinant Human Single-Stranded DNA Binding Protein 1 SSR2 pro-1380 Recombinant Human Signal Sequence Receptor, Beta SSR4 pro-1294 Recombinant Human Signal Sequence Receptor, Delta SSX1 pro-1379 Recombinant Human Synovial Sarcoma, X Breakpoint 1 STAMBP pro-017 Recombinant Human STAM Binding Protein STAMBPL1 pro-1354 Recombinant Human STAM Binding Protein Like 1 STAP1 pro-1110 Recombinant Human Signal Transducing Adaptor Family Member 1 STAR pro-979 Recombinant Human Steroidogenic Acute Regulatory Protein STIM1 pro-620 Recombinant Human Stromal Interaction Molecule 1 STIP1 pro-753 Recombinant Human Stress-Induced-Phosphoprotein 1 STMN1 pro-676 Recombinant Human Stathmin-1 STMN2 pro-752 Recombinant Human Stathmin Like-2 STMN3 pro-838 Recombinant Human Stathmin Like-3 Streptavidin pro-283 Streptavidin Streptavidin pro-791 Recombinant Streptavidin Streptavidin, His pro-621 Recombinant Streptavidin, His Tag Streptavidin-NC pro-338 Recombinant Streptavidin-NC STX11 pro-1111 Recombinant Human Syntaxin-11 STX12 pro-1099 Recombinant Human Syntaxin-12 STX1A pro-574 Recombinant Human Syntaxin-1A STX2 pro-1146 Recombinant Human Syntaxin-2 STX3 pro-1082 Recombinant Human Syntaxin-3 STX4 pro-1176 Recombinant Human Syntaxin-4 SUB1 pro-835 Recombinant Human SUB1 Homolog SUFU pro-938 Recombinant Human Suppressor of Fused Homolog SUGT1 pro-096 Recombinant Human SGT1 SUMF1 pro-986 Recombinant Human Sulfatase Modifying Factor 1 SUMO1 pro-326 Recombinant Human Small Ubiquitin-Related Modifier 1 SUMO1 His pro-980 Recombinant Human Small Ubiquitin-Related Modifier 1, His Tag SUMO2 pro-586 Recombinant Human Small Ubiquitin-Related Modifier 2 SUMO2 GST pro-541 Recombinant Human Small Ubiquitin-Related Modifier 2, GST SUMO3 pro-267 Recombinant Human Small Ubiquitin-Related Modifier 3 SURF1 pro-764 Recombinant Human Surfeit-1 SYCE3 pro-1179 Recombinant Human Synaptonemal Complex Central Element Protein 3 SYF2 pro-969 Recombinant Human SYF2 RNA splicing factor SYT1 pro-239 Recombinant Human Synaptotagmin I SYT4 pro-1375 Recombinant Human Synaptotagmin IV TAC1 pro-1338 Recombinant Human Tachykinin-1 TAC3 pro-716 Recombinant Human Tachykinin-3 TACSTD2 pro-157 Recombinant Human Tumor-Associated Calcium Signal Transducer 2 TAGLN pro-851 Recombinant Human Transgelin TAGLN2 pro-124 Recombinant Human Transgelin-2 TAGLN3 pro-946 Recombinant Human Transgelin-3 TANK pro-1348 Recombinant Human TRAF Family Member-Associated NFKB Activator TARDBP pro-1410 Recombinant Human TAR DNA Binding Protein TAX1BP3 pro-981 Recombinant Human Tax1 Binding Protein 3 TBCA pro-705 Recombinant Human Tubulin Folding Cofactor A TBCB pro-1127 Recombinant Human Tubulin Folding Cofactor B TBCC pro-1180 Recombinant Human Tubulin Folding Cofactor C TBPL1 pro-736 Recombinant Human TBP-Like 1 TBCEL pro-030 Recombinant Human Tubulin Folding Cofactor E-Like TCEA1 pro-1098 Recombinant Human Transcription Elongation Factor A (SII)- 1 TCEAL1 pro-507 Recombinant Human Transcription Elongation Factor A (SII)-Like 1 TCEAL3 pro-1128 Recombinant Human Transcription Elongation Factor A (SII)-Like 3 TCEAL7 pro-1147 Recombinant Human Transcription Elongation Factor A (SII)-Like 7 TCEAL8 pro-1188 Recombinant Human Transcription Elongation Factor A (SII)-Like 8 TCEB1 pro-1017 Recombinant Human Transcription Elongation Factor B Polypeptide 1 TCEB2 pro-664 Recombinant Human Transcription Elongation Factor B Polypeptide 2 TCL1A pro-726 Recombinant Human T-cell Leukemia/Lymphoma 1A TCP1 pro-276 Recombinant Human T-Complex 1 TES pro-549 Recombinant Human Testis Derived Transcript TEV pro-585 Recombinant Tobacco Etch Virus Protease TFAM pro-095 Recombinant Human Transcription Factor-A TFB1M pro-903 Recombinant Human Transcription Factor B1, Mitochondrial TFB2M pro-1259 Recombinant Human Transcription Factor B2, Mitochondrial TFPI2 pro-860 Recombinant Human Tissue Factor Pathway Inhibitor 2 TGFBI pro-568 Recombinant Human Transforming Growth Factor Beta Induced TGFBI 182 pro-672 Recombinant Human Transforming Growth Factor Beta Induced 182 a.a. THAP1 pro-1089 Recombinant Human THAP Domain Containing, Apoptosis Associated Protein 1 THBS1 pro-288 Recombinant Human Thrombospondin Thrombin pro-339 Human Thrombin THYN1 pro-270 Recombinant Human Thymocyte Nuclear Protein 1 Thyroglobulin pro-443 Human Thyroglobulin TIAF1 pro-1211 Recombinant Human TGFB1-Induced Anti-Apoptotic Factor 1 TICAM2 pro-1036 Recombinant Human Toll-Like Receptor Adaptor Molecule 2 TIFA pro-1041 Recombiant Human TRAF-Interacting Protein with Forkhead-Associated Domain TIRAP pro-1181 Recombinant Human Toll-Interleukin 1 Receptor (TIR) Domain Containing Adaptor Protein TMOD3 pro-1165 Recombinant Human Tropomodulin 3 TNIP1 pro-005 Recombinant Human TNFAIP3 Interacting Protein 1 TNNI1 pro-1269 Recombinant Human Troponin I Type 1 TNNI2 pro-1283 Recombinant Human Troponin I Type 2 TNNT2 pro-703 Recombinant Human Troponin T Type 2, Cardiac Isoform 3 TOLLIP pro-228 Recombinant Human Toll Interacting Protein TPD52L1 pro-442 Recombinant Human Tumor Protein D52 L1 TPM1 pro-469 Recombinant Human Tropomyosin-1 TPM2 pro-069 Recombinant Human Tropomyosin-2 TPM3 pro-1020 Recombinant Human Tropomyosin-3 TPM4 pro-187 Recombinant Human Tropomyosin-4 TPRKB pro-1185 Recombinant Human TP53RK Binding Protein TPT1 pro-776 Recombinant Human Tumor Protein Translationally-Controlled 1 TRAF1 pro-834 Recombinant Human TNF receptor-Associated Factor 1 TRAF2 pro-685 Recombinant Human TNF receptor-Associated Factor 2 Transferrin pro-747 Recombinant Human Transferrin TRAPPC2 pro-1272 Recombinant Human Trafficking Protein Particle Complex 2 TRAPPC3 pro-1056 Recombinant Human Trafficking Protein Particle Complex 3 TRAPPC4 pro-1273 Recombinant Human Trafficking Protein Particle Complex 4 TREM1 pro-457 Recombinant Human Triggering Receptor Expressed on Myeloid Cells 1 TRIM21 pro-328 Recombinant Human Tripartite Motif Containing 21 (RO52) Troponin 1 pro-341 Recombinant Human fast skeletal Troponin 1 Troponin I-C pro-344 Recombinant Human Cardiac Troponin I-C Complex Troponin I-C pro-345 Recombinant Single Chain Cardiac Troponin I-C Troponin I-C pro-346 Recombinant Single Chain Cardiac Troponin I-C 2nd generation Troponin-C pro-322 Recombinant Human Cardiac Troponin-C Troponin-C His pro-959 Recombinant Human Cardiac Troponin-C His Troponin-I pro-324 Recombinant Human Cardiac Troponin-I Troponin-T pro-342 Human Cardiac Troponin-T TROVE2 pro-329 Recombinant Human TROVE Domain Family Member 2 TROVE2 His pro-110 Recombinant Human TROVE Domain Family Member 2 His Tag Trypsin pro-770 Recombinant Human Trypsin Trypsin Yeast pro-786 Recombinant Human Trypsin, Yeast TSC22D3 pro-1254 Recombinant Human TSC22 Domain Family, Member 3 TSEN15 pro-144 Recombinant Human tRNA Splicing Endonuclease 15 TSG101 pro-805 Recombinant Human Tumor Susceptibility Gene 101 TSN pro-271 Recombinant Human Translin TSNAX pro-1292 Recombinant Human Translin-Associated Factor X TSSC4 pro-1021 Recombinant Human Tumor Suppressing Subtransferable Candidate 4 TTC1 pro-1160 Recombinant Human Tetratricopeptide Repeat Domain 1 TTC32 pro-1246 Recombinant Human Tetratricopeptide Repeat Domain 32 TTC33 pro-1217 Recombinant Human Tetratricopeptide Repeat Domain 33 TUBB3 pro-1388 Recombinant Human Tubulin, Beta 3 Class III TUBG1 pro-982 Recombinant Human Tubulin Gamma 1 TULP1 pro-1191 Recombinant Human Tubby Like Protein 1 TWF1 pro-1003 Recombinant Human Twinfilin-1 TXN1 pro-334 Recombinant E.Coli Thioredoxin TXN1 pro-569 Recombinant Human Thioredoxin TXN1, His pro-784 Recombinant E.Coli Thioredoxin, His TXN1, His pro-804 Recombinant Human Thioredoxin His Tag TXN2 pro-625 Recombinant Human Thioredoxin-2 TXNDC12 pro-1133 Recombinant Human Thioredoxin Domain Containing 12 TXNDC17 pro-1055 Recombinant Human Thioredoxin Domain Containing 17 TXNL1 pro-084 Recombinant Human Thioredoxin-Like 1 TXNL4A pro-1100 Recombinant Human Thioredoxin-Like 4A TXNL4B pro-238 Recombinant Human Thioredoxin-Like 4B TYW5 pro-1315 Recombinant Human tRNA-yW Synthesizing Protein 5 U. Urealyticum pro-670 Recombinant Ureaplasma Urealyticum Parvum UBD pro-927 Recombinant Human Ubiquitin-D Ubiquitin pro-314 Recombinant Human Ubiquitin Ubiquitin Biotin pro-629 Recombinant Human Ubiquitin Biotin Ubiquitin G76A pro-280 Recombinant Human Ubiquitin Gly76 to Ala76 mutation Ubiquitin GST pro-735 Recombinant Human Ubiquitin, GST Tag Ubiquitin K48R pro-372 Recombinant Human Ubiquitin Lys 48 to Arg 48 mutation UBL3 pro-230 Recombinant Human Ubiquitin-Like 3 UBL4A pro-1043 Recombinant Human Ubiquitin-Like 4A UBL5 pro-231 Recombinant Human Ubiquitin-Like 5 UBTD2 pro-1203 Recombinant Human Ubiquitin Domain Containing 2 UFM1 pro-125 Recombinant Human Ubiquitin-Fold Modifier 1 UFSP1 pro-1320 Recombinant Human UFM1-Specific Peptidase 1 ULBP2 pro-1134 Recombinant Human UL16 Binding Protein 2 Ulinastatin pro-608 Recombinant Human Urinary Trypsin Inhibitor (UTI) Ulinastatin pro-321 Human Urinary Trypsin Inhibitor (UTI) UNC119B pro-1034 Recombinant Human UNC-119 Homolog B UPK2 pro-479 Recombinant Human Uroplakin 2 UPK3A pro-988 Recombinant Human Uroplakin 3A UQCRC2 pro-1224 Recombinant Human Ubiquinol-Cytochrome C Reductase Core Protein II URM1 pro-188 Recombinant Human Ubiquitin Related Modifier 1 USH1C pro-706 Recombinant Human Usher Syndrome 1C USP14 pro-016 Recombinant Human Ubiquitin Specific Peptidase 14 UTP23 pro-1235 Recombinant Human UTP23, Small Subunit Processome Component UXT pro-1312 Recombinant Human Ubiquitously-Expressed, Prefoldin-Like Chaperone VAMP1 pro-577 Recombinant Human Synaptobrevin-1 VAMP2 pro-578 Recombinant Human Synaptobrevin-2 VAMP3 pro-652 Recombinant Human Synaptobrevin-3 VAMP4 pro-714 Recombinant Human Vesicle-Associated Membrane Protein 4 VAMP5 pro-681 Recombinant Human Synaptobrevin-5 VAMP7 pro-1194 Recombinant Human Vesicle-Associated Membrane Protein 7 VAMP8 pro-660 Recombinant Human Synaptobrevin-8 VAPA pro-779 Recombinant Human VAMP Associated Protein A, 33kDa VAPB pro-014 Recombinant Human VAMP Associated Protein B and C VASP pro-191 Recombinant Human Vasodilator-Stimulated Phosphoprotein VAT1 pro-1011 Recombinant Human Vesicle Amine Transport Protein 1 Homolog VBP1 pro-1325 Recombinant Human Von Hippel-Lindau Binding Protein 1 VCAM1 pro-386 Recombinant Human Vascular cell adhesion molecule 1 VDR pro-205 Recombinant Human Vitamin D Receptor VHL pro-440 Recombinant Human Von Hippel-Lindau Protein Vimentin pro-309 Recombinant Human Vimentin Vimentin GST pro-734 Recombinant Human Vimentin, GST Tag VOPP1 pro-200 Recombinant Human Vesicular Overexpressed in Cancer, Prosurvival Protein 1 VPS24 pro-872 Recombinant Human Vacuolar Protein Sorting 24 VPS25 pro-1054 Recombinant Human Vacuolar Protein Sorting 25 VPS26A pro-1161 Recombinant Human Vacuolar Protein Sorting 26A VPS28 pro-730 Recombinant Human Vacuolar Protein Sorting 28 VPS29 pro-1075 Recombinant Human Vacuolar Protein Sorting 29 mVPS29 pro-1066 Recombinant Mouse Vacuolar Protein Sorting 29 VRK3 pro-1130 Recombinant Human Vaccinia Related Kinase 3 VSNL1 pro-723 Recombinant Human Visinin-Like Protein-1 VSNL1 His pro-602 Recombinant Human Visinin-Like Protein-1 His Tag VSTM2L pro-1018 Recombinant Human V-Set and Transmembrane Domain Containing 2 Like VTA1 pro-1044 Recombinant Human Vps20-Associated 1 Homolog VTI1B pro-1115 Recombinant Human Vesicle Transport Through Interaction with t-SNAREs Homolog 1B WBP2 pro-1208 Recombinant Human WW Domain Binding Protein 2 WDR5 pro-863 Recombinant Human WD Repeat Domain 5 WHSC2 pro-062 Recombinant Human Wolf-Hirschhorn Syndrome Candidate 2 WIBG pro-864 Recombinant Human within BCGN Homolog WIF1 pro-684 Recombinant Human WNT Inhibitory Factor 1 WLS pro-1402 Recombinant Human Wntless XAGE1A pro-1256 Recombinant Human X Antigen Family, Member 1A XG pro-1395 Recombinant Human XG Blood Group XPA pro-026 Recombinant Human Xeroderma Pigmentosum, Complementation Group A YEATS4 pro-1019 Recombinant Human YEATS Domain Containing 4 yTXN1 pro-333 Recombinant Yeast Thioredoxin 重慶市華雅干細(xì)胞技術(shù)有限公司 |